yoga




FC2SQTENGODSTARSHDKAGMEMCAWDPPPDMVSDMIAARBDHODVLULUMIDVSSNIJUFENACRBBANHUNTBABWPRED

2021-01-04
89 min

435MFC-070 [Gonzo] Tsumutsumu / 20 years old / Female college student * Defeat Saddle with a perverted JD who masturbates during class with a neat face! With masturbation, with vaginal cum shot, with facial cumshots, SEX! !!

  • amateur censoredcreampieamateurmfcmfc-070mfc070435mfc-070
    • 2021-01-16
    59 min

    10musume 011621_01 Not Wearing Make up Amateur : Look At My No Makeup Ordinary Face Masako Sawamura

  • amateur uncensored10musume
    • 2021-01-17
    119 min

    [SCD-189]Raw Creampie Into A 50-something Mom With Bit Tits - Aki Misato

  • aki misato censoredmature womansingle workSCDrubysuke kato 6scoopSCD-189SCD189scd00189
    • 2021-01-19
    62 min

    HEYZO 2443 Orgasms With A Horny Pussy Girl Vol.11 – Kana Takashima

  • kana takashima uncensoredcreampieheyzo
    • 2021-01-22
    130 min

    [KUM-012]Intruder 02

  • censoredcreampiebdsmKUMprestigejanhirokyuryu prestigeKUM-012KUM012118kum00012
    • 2021-02-02
    72 min

    [IMPNO-030]Tokyo Academy - Her First Ever Anal - Field Trip Recreation / Kami Shimoshiraishi

  • shimoshiraishi neshin censoredanalsingle workIMPNOimpactnon label impactIMPNO-030IMPNO030h-1154impno00030
    • 2021-02-05
    50 min

    FC2PPV 1673902 [Uncensored] Rookie J ● The back part-time job of Miss Refre! Serious Seeding Creampie Press for Miriya-chan (19 Years Old) !! J ● Miss Refre: Miriya-chan (19 Years Old)

  • amateur uncensoredfc2
    • 2021-02-12
    84 min

    [DORI-012]Fuck Video No.12 "I Want You To Stick Your Raw Cock Into Me!" This Spoiled J* Is Opening Up Her Legs And Begging For Sex And She Was So Adorable That I Gave Her 2 Creampie Fucks!

  • censoredcreampieschoolgirlDORIfirst starsucking shootingDORI-012DORI012h-491dori00012
    • 2021-02-19
    114 min

    [ISD-134]Nation-Wide Jukujo Sousakutai - Overnight Trips To The Country! Chichibu, Saitama Edition - Kasumi Ikeya

  • ayumi tsubasa azusa kirihara azusa ito censoredlesbianISDrubymaterukazu umiyamaISD-134ISD13421isd00134
    • 2021-02-19
    41 min

    [BTH-122]Fuck Meeting With a Celebrity-Level Cosplayer Meisa Asagiri

  • asagiri meisa censoredblowjobBTHchobitchchovicBTH-122BTH122h-1435bth00122
    • 2021-03-07
    69 min

    300NTK-535 [Effect techmen hot tide aphrodisiac! !! ] Seriously beautiful girl girls bar clerk rushes into explosion mode with drunk & aphrodisiac! !! De Nasty Gangimari’s Squirting Ma ○ Ko! !! Slender beautiful flesh sensation ass with libe

  • amateur censoredcreampiesquirtingntkntk-535ntk535300ntk-535
    • 2021-03-13
    119 min

    [IPX-623]Ms. Rio Is A Blatantly Cute Babe Who Will Suck The Shit Out Of Your Cock With A Smile With An Amazing Blowjob Rio Kuriyama

  • rio kuriyama censoredblowjobsingle workIPXidea pocketdishIPX-623IPX623ipx00623
    • 2021-03-19
    87 min

    383REIW-040 Kanon

  • amateur censoredbig titsamateurreiwreiw-040reiw040383reiw-040
    • 2021-03-23
    48 min

    Pacopacomama 032321_450 Married Pussy Encyclopedia : Deluxe Edition Kanon Mikoshiba

  • amateur uncensoredpacopacomama
    • 2021-04-01
    16 min

    Caribbeancom 040121-001 Anal Encyclopedia : Mitsuha Kikukawa

  • amateur uncensoredanalcaribbeancom
    • 2021-04-02
    117 min

    [JUL-523]Electric Transfer Kanna Hirai Madonna Only First Release! Step Mother And Step Son Have Mindless Sweaty Homecoming Sex In The Heat Of Summer

  • shiori hirai censoredcreampiebig titsJULmadonnamametaro mamezawaJUL-523JUL523jul00523
    • 2021-04-02
    78 min

    383REIW-053 Saya

  • amateur censoredamateurreiwreiw-053reiw053383reiw-053
    • 2021-05-02
    240 min

    [YLWN-166]Sex Diary With My Friend's Mother 4 Hours

  • censoredmarried womanmilfYLWNyellow moonpatpong tateishiYLWN-166YLWN166ylwn00166
    • 2021-05-07
    118 min

    [IPX-657]"We Won't Tell My Sister, Ok？" Infidelity: My Girlfriend's Older Sister Wasn't Wearing Panties - I Couldn't Resist The Temptation To Cheat. Anna Kami

  • anna kami yukino censoredblowjobsingle workIPXidea pocketkyoseidishIPX-657IPX657ipx00657
    • 2021-05-20
    50 min

    Pacopacomama 052021_479 Sex at front door 27 – Karin Morishita

  • amateur uncensoredpacopacomama
    • 2021-05-27
    79 min

    200GANA-2491 Seriously Nampa, first shot. 1641 A genuine blonde Caucasian beauty who walks dashingly on Omotesando! When you gently touch her ears, she looks stunned … Maybe she’s weak against pushing, she shows off her pure white naked bod

  • amateur censoredamateurganagana-2491gana2491200gana-2491
    • 2021-05-29
    116 min

    [KTKZ-087]"I'm Poor, Please Save Me!" Single Mother Breast Milk, Up Close And Personal Documentary Yuki (20)

  • censoredamateurbeautiful girlKTKZkitixx mousouzokushinjinKTKZ-087KTKZ087ktkz00087
    • 2021-05-29
    182 min

    [SQIS-052]Made To Have Some Rough Sexual Relations

  • censoredmature womanmomSQISfa proSQIS-052SQIS052sqis00052
    • 2021-06-04
    121 min

    FC2PPV 1851765 980 yen! The contents are full ♪ After all, an angel! ？？ All you want to do for a beautiful girl with big breasts ♪ Full of back ops (rimming, facial cumshots, electric drill, anal fingering) Angel Naten-chan gets sharp？ One vaginal cu

  • amateur uncensoredfc2
    • 2021-06-12
    141 min

    [USAG-031]The Sisterly Type. Hikaru (19) Tanned Gal / Hard Thrusting / Super Sweet / Shaved Pussy / Hot Ass / Creampie Sex / 3 Full Fucks / Pov / Three-Some / You'd Never Guess How Slutty She Is

  • censoredUSAGrabbit daydreamersUSAG-031USAG031usag00031
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-19
    155 min

    [JUL-614]Seduced By My Mother-In-Law Who's Always Hungry For My Big Dick Marina Shiraishi

  • rena shiraishi censoredbig titsmature womanJULmadonnakogoro kindaichiJUL-614JUL614jul00614
    • 2021-06-24
    120 min

    [FSDSS-245]Reverse Cuckolding: "But My Wife Is Waiting For Me At Home..." Having Missed The Last Train Home After A Friday Night Company Party, I Ended Up In A Hotel Alone With My Big-Titted Younger Coworker. She Went Total Slut On Me And Mil

  • yuko ono censoredbig titssingle workFSDSSfalenoyamaguchi memberfaleno starFSDSS-245FSDSS2451fsdss00245
    • 2021-06-26
    160 min

    [LULU-082]This Horny Bitch Mama Used Her K-Cup Colossal Tits To Drain Her Son's Friend's Cock Until It Was Bone Dry Because That's The Kind Of Vulgar Slutty Cunt She Is Eri Takigawa

  • eri takikawa misato arisawa censoredcreampiebig titsLULUlunaticsvagmanLULU-082LULU082lulu00082
    • 2021-06-26
    55 min

    Caribbeancom 062621-001 Caribbebians: Addicted to elaborate lesbian play Shino Aoi, Yu Toyota

  • amateur uncensoredlesbiannursecaribbeancom
    • 2021-07-02
    118 min

    [JBD-269]Anal Rope Princess: The Birth Of A True Masochist Girl Alice

  • otsu alice censoredanalbig titsJBDattackersnavejabakuJBD-269JBD269jbd00269
    • 2021-07-03
    110 min

    [ANB-191]I'm Obsessed With My Beautiful And Erotic Step Aunt's Gorgeous Big Tits And Super Sexy Body Yuki Inaba

  • yuki inaba censoredsquirtingmature womanANBrubysusumu yanokuchinobleANB-191ANB191anb00191
    • 2021-07-08
    65 min

    200GANA-2517 In The Spear Room Of The Nampa Master Of Hyakusen Hakusen, Bring In SEX Hidden Camera 210 Bring In The Half Face Musume That I Called After A Long Time And Immediately SEX! Slender and fair body! Beautiful legs with big breasts and nice

  • amateur censoredbig titsamateurganagana-2517gana2517200gana-2517
    • 2021-07-15
    110 min

    [JURA-039]The Dear Wife, First Time In Her 50s, Again. Saeko Ikegami.

  • saeko ikegami censoredcreampiemarried womanJURAcenter villagejiro fukagawajurakuJURA-039JURA039h-086jura00039
    • 2021-07-17
    23 min

    FC2PPV 1927891 [Toys] A 145 Cm Mini Girl! Husband Is Not Good. It’S Too Intense And Patience, Wow, [Personal Shooting]

  • amateur uncensoredfc2
    • 2021-08-13
    82 min

    300MIUM-735 Big Tits Beauty With Too Erotic Hami Milk! !! [Beautiful Skin F Milk! & Puru Puru Momojiri! & Beautiful Constricted Body! !! ] × [Super Sensitive Shaved Pussy That Squirts Many Times With Fingering ● Ko! !! !! ] The Case That It Was

  • amateur censoredbig titsamateurmiummium-735mium735300mium-735
    • 2021-09-09
    148 min

    [HAWA-259]She Gets Wet Just From Looking. 110cm Bust K-cup, 100cm Hips. Colossal Tits And Curvy Ass, Secretly Slutty Wife. "Lewd Daydream That Never Ends..." Impressive Body Takes A Hard Dick For Fucking!! Akiho-san (34 Years Old).

  • censoredbig titsHAWAkosumosu eizouhide monkcosmospictures soft on demandHAWA-259HAWA2591hawa00259
    • 2021-09-11
    240 min

    [CADV-825]My Favorite Girlfriend Sachiko

  • sachiko censoredcreampieCADVcrystal picturecrystal exCADV-825CADV825cadv00825
    • 2021-09-14
    65 min

    Pacopacomama 091421_531 Married Woman And Brother-In-Law Suffering From Bad Husband Rina Shirakawa

  • amateur uncensoredpacopacomama
    • 2021-09-24
    119 min

    [JUL-726]Even Though My Wife, Who Has A Strong Sense Of Justice, Protected Me From My Delinquent Senior Colleagues, I Cannot Do Anything. Sumire Tamba

  • niwa sumire censoredcreampiemature womanJULmadonnamishima rokusaburoJUL-726JUL726jul00726
    • 2021-09-25
    241 min

    [ITSR-096][Seduce Mature Women Like This!!] Pickup Artist 4 Hours 12 Women, Here Are Hot Mature Women Who Can"t Resist Their Macho Instructor.

  • censoredcreampiemarried womanITSRbig mocalmaxtop itadakiITSR-096ITSR09657itsr00096
    • 2021-10-01
    142 min

    [SHKD-967]A Roughly Fucked Exchange S*****t - Runa Tsukino

  • tsukino luna censoreduniformsingle workSHKDattackersjo styleshi yoru akuSHKD-967SHKD967shkd00967
    • 2021-10-02
    51 min

    C0930 hitozuma1364 Miharu Nozaki 33years old

  • amateur uncensoredc0930
    • 2021-10-07
    125 min

    [DLDSS-032]My Father-in-Law Gives Me a Creampie Every Night. Ayaka Tomoda

  • ayaka tomoda censoredcreampiedeepthroatDLDSSdahliasaigou shouDLDSS-032DLDSS0321dldss00032
    • 2021-10-09
    24 min

    FC2PPV 2319995 Because Of Its Popularity! Appearance! "# 8" Active Model. She Is Raped By A Leap Demon And Has Teary Eyes. Even If I Refuse, Forced Vaginal Cum Shot → Comfort Etch ♡ Both Feelings ♡

  • amateur uncensoredfc2
    • 2021-10-21
    101 min

    [REBD-596]Aika 2 - The White Dancing Princess Of The Ryukyus - Aika Yamagishi

  • aika yamagishi censoredsingle workREBDrebeccakawaREBD-596REBD596h-346rebd00596
    • 2021-10-26
    63 min

    [500DPL-0049]スーパードキュメント屋台ファック～おでん屋編～彩水香里奈

  • amateur censoredamateurdpldpl-0049dpl0049500dpl-0049
    • 2021-10-27
    50 min

    [541AKYB-042]みく(20)【金髪ギャル】【中出し】【お掃除フェラ】

  • amateur censoredcreampieamateurakybakyb-042akyb042541akyb-042
    • 2021-11-11
    154 min

    [NHDTB-597]Chasing Creampie 2 -Following A Group Of Gals All Day And Fucking Them All

  • censoredcreampiesquirtingNHDTBnatural highjaken kodamaNHDTB-597NHDTB5971nhdtb00597
    • 2021-11-19
    125 min

    [BHSP-026]Basketball Player Who Is A Gymnast And A Masochist Saori Asahina

  • saori asahina censoredcreampiedeepthroatBHSPtoyohikozarakiseiunkaiBHSP-026BHSP026bhsp00026
    • 2021-11-19
    231 min

    [HUNTB-149]"Can"t I Thank You With My Body？ I"m Not A K*d..." Even Though This Runaway Girl Hijacked My Room, She"s So Cute I Kind Of Like Her...

  • censoredcreampieschoolgirlHUNTBhuntercognac kaminohhh groupHUNTB-149HUNTB149huntb00149
    • 2021-11-27
    50 min

    H4610 ki211128 Natsuko Hayasaka 18years old

  • amateur uncensoredh4610
    • 2021-11-30
    120 min

    [SAN-031]A Florist"s Plundering Love! A Wife"s Thoughts In The Language Of Dahlia Flowers

  • squid censoredsingle workdramaSANmazakisakura kabinmother mazaSAN-031SAN031h-796san00031
    • 2021-12-04
    27 min

    FC2PPV 2485782 [First Gonzo] Prefectural Ordinary Course (2) A Child Who Works Part-Time At A Frequently Visited School * Weekend Limited Price

  • amateur uncensoredfc2
    • 2022-02-05
    194 min

    [CEMD-125]True Nature Of Tipsy AV Actresses! Mina Kitano! After Pulling Away The Mask, A New Face Of Mina Kitano Is Revealed!

  • mina kitano censoredcreampiebig titsCEMDceleb no tomoCEMD-125CEMD125cemd00125
    • 2022-02-19
    45 min

    FC2PPV 2674595 [1 Week Limited 7800 → 3980] [No / Face Bleached Solo / Face Bleached Orgy / 2 Works + Pet, Continuous Blowjob Total 90 Minutes] Cheeky Fair-Skinned Half Beauty. She Keeps Committing Until She Is Satisfied With A Lot Of Men And Vaginal

  • amateur uncensoredfc2



    • Jav Cherry, watch JAV streaming online japanese xxx