shido




FC2APODSSNISANBLKVENXNGODDASDAMBIIPXMEYDHNDSPRDMILKCAWDFSDSSSSISWANZHMNSTARSNACR

2020-10-27
179 min

[RDVHJ-124]Picking Up Slutty Girls At The Bar 7

  • censoredcreampiesquirtingRDVHJgraffiti japanfairestRDVHJ-124RDVHJ12448rdvhj00124
    • 2020-11-01
    78 min

    300MAAN-595 [Tenisa JD / Jujin Body / Animal Cosplay] If you have sex, this is the body! !! Sensitive plump erotic body with smooth skin that makes you want to poke your uterus like crazy! !! The estrus period has arrived with Animal Cosplay! !! Shak

  • amateur censoredcreampieamateurmaanmaan-595maan595300maan-595
    • 2020-11-05
    84 min

    [REBD-505]Miharu3 Resort * LOVE - Miharu Hasaki

  • miharu hanasaki censoredsingle workREBDrebeccazaku araiREBD-505REBD505h-346rebd00505
    • 2020-11-13
    125 min

    [ESK-316]The Escalatin Actions Of An Amateur Girl 316 - Sena-chan, 21 Years Old

  • censoredamateurESKprestigedamashiyaESK-316ESK316118esk00316
    • 2020-11-18
    51 min

    FC2PPV 1574613 [Active Yoga Instructor] Breaking the Race Queen Glossy Pantyhose (Direct Wearing) and Sliding And Cum Shot In A Slimy Pussy! The costume that clings to the F cup body of the highleg mistress who bites in is the best fetishism!

  • amateur uncensoredfc2
    • 2020-11-22
    103 min

    428SUKE-049 [Red-haired gal player playing moistened] Pakopako SP at a hotel with a gal who invites you to charge your smartphone and plays the clarinet! !! Ejaculation is inevitable with big fucking! ？？ A vibe is sucked in Ma ● Ko, a lewd bare blowj

  • amateur censoredcreampiebig titssukesuke-049suke049428suke-049
    • 2020-11-28
    65 min

    H4610 ki201128 Rrquest

  • amateur uncensoredh4610
    • 2020-12-10
    180 min

    [SW-742]I Took A Bath With My Busty Adult Stepsisters! They Started Teasing Me And I Got Hard, So When I Got Them Alone I Nailed Each Of Them For Thrice The Pleasure!

  • censoredbig titsSWswitchyocchanswitch switchSW-742SW7421sw00742
    • 2020-12-11
    42 min

    [SHYN-136]Female SOD Employee Boxed Into Japanese Strip Games We Play Hardball With Our Location Prep Girl! Production Department Employee Rika Hirose

  • rika hirose censoredbeautiful girlSHYNsod createy 10432sod female employeeSHYN-136SHYN1361shyn00136
    • 2020-12-24
    80 min

    435MFC-066 G Breast Nursery Teacher And Nasty Cheating SEX! Even though I have a bad relationship with my child’s father, I can’t stop because of the excellent compatibility! Finally, Gonzo with a metamorphosis teacher who will show off her

  • amateur censoredcreampiebig titsmfcmfc-066mfc066435mfc-066
    • 2020-12-25
    47 min

    416SVMM-038 Mirei

  • amateur censoredcreampiesquirtingsvmmsvmm-038svmm038416svmm-038
    • 2020-12-25
    51 min

    [MASE-009](Online Only) Madam In Her Forties - Wealthy Wife - Horny & Creampie-Crazed

  • censoredcreampiemarried womanMASEcrystal picturemadam maniac plusMASE-009MASE00949mase00009
    • 2020-12-26
    43 min

    FC2PPV 1621245 [New account sale 1980 → 1280 1/10] * For some reason, the sample hides the face. [4K] Main story appearance [Individual shooting] Lady girls’ school FJK! Raw insertion Gonzo w vaginal cum shot refusal to fair-skinned girl → helpe

  • amateur uncensoredfc2
    • 2020-12-26
    45 min

    [per-356]いつき 2

  • amateur censoredamateurblowjobperper-356per356per-356
    • 2021-01-01
    60 min

    HEYZO 2428 Discrete Maid Is Ready For Naughty Care Vol.11 – Emi Aoi

  • emi aoi uncensoredcreampieblowjobheyzo
    • 2021-01-03
    61 min

    10musume 010421_01 With My Friend: Play Red light, Green light With Adult Toy Yu Nagata Haruna Kawai

  • amateur uncensored10musume
    • 2021-01-20
    130 min

    [GVH-181]I'm Your Sex Pet... You Can Order Me To Do Whatever You Want, And I'll Obey... Awakening As A Sub Urara Kanon

  • hanaoto urara censoredbdsmsingle workGVHglory questGVH-181GVH18113gvh00181
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-11
    110 min

    [GS-374]I Teased The Part-Time Girl At Work Sexually... And She Gave Me A Naughty Smile And Proposed A Deal!

  • censoredamateurGSsosoru x garconred ballGS-374GS374h-101gs00374
    • 2021-02-18
    46 min

    [oretd-847]須崎さん

  • amateur censoredcreampieuniformoretdoretd-847oretd847oretd-847
    • 2021-02-22
    84 min

    [MCKT-016]Hot Girls Who Love To Party! Girls Pick Up Guys To Fuck On The Street Corner Hibiki Otsuki

  • otsuki sound censoredcreampieMCKTchikikikikama delusion groupMCKT-016MCKT016mckt00016
    • 2021-02-26
    64 min

    SIRO-4418 [First shot] [Best fucking that covers the big cock] [Baby face x H beautiful breasts] A young-faced airport employee working on an international flight. She disturbs H milk with outstanding destructive power that is not defeated by foreign

  • amateur censoredbig titsamateursirosiro-4418siro4418siro-4418
    • 2021-02-27
    76 min

    300MAAN-629 [Ultimate Saseko Advent] An ideal extreme erotic BODY that you can’t think of as neat (self-proclaimed)! Bubble ass job play to play with each other in the bath! Unique to soft girls! Adhesion etch in an impossible position! !! Super

  • amateur censoredcreampieamateurmaanmaan-629maan629300maan-629
    • 2021-03-02
    64 min

    Pacopacomama 030221_441 The call girl in front of the door is my cousin？! Emiko Kasai

  • amateur uncensoredpacopacomama
    • 2021-03-06
    97 min

    [SHKD-936]A Pretty Girl In Pure White Gets Dirty - Sakura Tsukino

  • tsukino sakura censoredsingle workSHKDattackerssayaka datesharkSHKD-936SHKD936shkd00936
    • 2021-03-08
    44 min

    302GERK-354 Ichika

  • amateur censoredcreampieamateurgerkgerk-354gerk354302gerk-354
    • 2021-03-17
    76 min

    376H-621 Bondage Innocent Uniform Girls ●● Squid With SEX! ＃ Narumi ＃ 18 years old

  • amateur censoredcreampieuniformhh-621h621376h-621
    • 2021-05-01
    123 min

    [NGOD-147]Woman From The Convience Store Headquarters 5 Yui Hatano

  • yui hatano censoredbig titsslutNGODjet eizomanji groupNGOD-147NGOD147ngod00147
    • 2021-06-03
    487 min

    [ABBA-521]These Mosaic Censorship Technicians Have Selected A Masterpiece Collection Of Sex Scenes So Amazing And Furious That They Got Erections While Working 2 50 Videos 8 Hours 2-Disc Set

  • censoredcreampiemarried womanABBAcenter villageABBA-521ABBA521h-086abba00521
    • 2021-06-06
    90 min

    300NTK-583 Active Gravure Superb Style G Breasts! !! Start from wearing erotic shooting! !! It is inevitable to induce a good desire in a swimsuit with no cloth area of a beautiful woman who can push it completely! !! Heat with sexy pose instruction!

  • amateur censoredcreampiebig titsntkntk-583ntk583300ntk-583
    • 2021-06-08
    123 min

    [STARS-390]She Swallows Your Whole Cock Until You Cum - Long-Licking Blowjob. Hibiki Natsume (Bust Your Nut In Incredible 4K Resolution!)

  • natsume hibiki censoredblowjobbeautiful girlSTARSsod createsuisei akaisod starSTARS-390STARS3901stars00390
    • 2021-07-02
    68 min

    520SSK-010 Ai

  • amateur censoredcreampieuniformsskssk-010ssk010520ssk-010
    • 2021-07-03
    56 min

    H4610 tk0038 Mihane Uemaki 20years old

  • amateur uncensoredh4610
    • 2021-07-06
    65 min

    SIRO-4572 [First shot] [Affair of a serious wife] [Beautiful breasts x nice ass x married woman] A serious married woman who is absorbed in the first strange stick sex. A fleeting voice echoed throughout the room, forgetting her husband only today ..

  • amateur censoredmarried womanamateursirosiro-4572siro4572siro-4572
    • 2021-07-14
    119 min

    [RKI-615]Sex Work At Home: A Fresh Face In The Industry Sets Up Her Own Underground Business, Her Client's Demands Escalate Until She Gets Creampied - Hana Shirato

  • white peach censoredcreampiebeautiful girlRKIrookietake dRKI-615RKI615rki00615
    • 2021-07-17
    124 min

    [HMN-025]I Heard That My Girlfriend's Older Sister Was Going To Make Her Sex Club Debut, So ... My Girlfriend's Older Sister And Her Friend (Another Sex Worker) Called Me Out For A Reverse Threesome Pin-Down Creampie Attack And Used Me As Tar

  • riho fujimori tsujii honoka censoredcreampiebig titsHMNhon nakamiyoshi rusherHMN-025HMN025hmn00025
    • 2021-07-23
    107 min

    [DAVK-066]"So All Of You Are Older Than My Father ..." This Shy And Super Serious Honor S*****t With An Adolescent Body Is Getting Sprayed With Massive Loads Of Semen By Obese Middle-Aged Men In A 7-Way Large Orgies Fuck Fest (She's Cummi

  • censoredcreampieuniformDAVKtmatakashi hashidadoujin av clubDAVK-066DAVK06655davk00066
    • 2021-08-15
    65 min

    300NTK-619 [Superb P Active Beauty X G Cup Beauty Big Tits X Tide Correspondence! !! ] The Finest Pink Nipples Tremble And Feel The Tide! !! Tokuno Service Over Guarantee! !! Full Erection Is Inevitable For P Active Beauty Who Works Hard! !! Gachi Er

  • amateur censoredcreampiebig titsntkntk-619ntk619300ntk-619
    • 2021-09-07
    100 min

    FC2PPV 2172250 The Real End! Sora-Chan Last Sex & Virgin Brush Wholesale.

  • amateur uncensoredfc2
    • 2021-09-09
    132 min

    [SPRD-1456]Asking My Father-in-law To Make Me Pregnant Without Telling My Husband Hana Haruna

  • haruna hana censoredmature womansingle workSPRDtakara eizouhotate ikkanaleddinSPRD-1456SPRD145618sprd01456
    • 2021-09-11
    155 min

    [SCOP-738]"Because You"re Truly Special..." It Was Only Supposed To Be To Comfort Me, And Just For One Night, But When My Best Friend Offered To Sleep Next To Me, I Couldn"t Resist Her Female Scent, Her Warmth, And The Way She Felt To

  • censoredcreampiebeautiful girlSCOPk m producek tarouscoop kmpSCOP-738SCOP738scop00738
    • 2021-09-14
    41 min

    H4610 ki210914 Haruka Tasaki 26years old

  • amateur uncensoredh4610
    • 2021-11-05
    151 min

    [SSIS-229]Miharu Usa Is In A 24-Hour Orgasmic State Of Amazing Pleasure With A Lifetime"s Worth Of Fucking As Her Lewd Nipples Shiver While She Gives It Her All For Wild And Intense Sex.

  • miharu hanasaki censoredbig titsbeautiful girlSSISs1 no 1 stylemonSSIS-229SSIS229ssis00229
    • 2021-11-06
    134 min

    [BAHP-094]Breaking In Masochistic Women Club - Sara Kanami

  • kagami sara censoredsingle workbukkakeBAHPbarutanusubashi suihoppinBAHP-094BAHP094bahp00094
    • 2021-11-11
    225 min

    [MOGI-006]体育会系美少女初音あきら(仮)21歳 学校帰りに性感を開発されまくる4本番225分〜耳、乳、膣、クリ全部合わせて合計69イキ〜

  • censoredMOGIsod createichinose kurumimogitateMOGI-006MOGI006
    • 2021-11-12
    119 min

    [EBOD-868]E-BODY Has Pursued The Ultimate In Women"s Bodies, And Now, They Present You With The Latest In Camera Technologies To Film A Natural Airhead Megaton J-Cup Titty Babe With A Voluptuous Body High Definition Video The Ultimate Female Body

  • kisaki alice censoredbig titsblowjobEBODe bodyarashiyama michiruEBOD-868EBOD868ebod00868
    • 2021-11-19
    32 min

    FC2PPV 2446853 [No] [Limited To 100 Pieces Off From 2980 To 1480pt!] Appeared After A Long Time! Active 〇〇 Office Work Slender Model Body Shape Beauty ♥ ️ Hard Profession Girls Have Stronger Libido？ * Review Benefits / High Image Quality Ver

  • amateur uncensoredfc2
    • 2021-11-25
    240 min

    [SW-812]Step-daughter Gives A Panty Shot With Her Curvy Ass That"s Just Too Much Temptation! "Tell Me More About The Naughty Things Step-mom Can"t Know About" Fakecest Dream Special - Step-daughter And Step-dad Compilation. That Body

  • censoredSWswitchyocchanswitch switchSW-812SW8121sw00812
    • 2021-12-03
    143 min

    [WAAA-125]Unexpected Raw Fucking When Condom Broke! Multiple Creampies WIth Ultra-Fast Piston! Kasumi Tsukino

  • kasumi tsukino censoredcreampiebig titsWAAAwanz factoryWAAA-125WAAA125waaa00125
    • 2021-12-03
    141 min

    [HEYZO-2688]tong jenny waan Sex in Asia ＃Tong ＃Jenny ＃Waan

  • amateur uncensoredheyzo
    • 2021-12-25
    150 min

    [ANKB-005]Carnal Hot Spring Play With I-cup Big Tits Erotic Nipple Shortcut Girl

  • censoredcreampiebig titsANKBlove p ssy daydream tribetake chanANKB-005ANKB005ankb00005
    • 2021-12-26
    75 min

    345SIMM-683 [Slender Little J ○ Immature Ma ○ Ko With Uncle Ji ○ Po Gun Thrust! !! ] "Yume-Chan" Can’t Be Very Honest In Front Of Her Favorite Person. However, My Uncle’s Tech Makes My Mind And Body Obedient … Licking The Sweat

  • amateur censoredcreampieuniformsimmsimm-683simm683345simm-683
    • 2022-01-19
    40 min

    279UTSU-528 Ran

  • amateur censoredcreampiebig titsutsuutsu-528utsu528279utsu-528
    • 2022-02-18
    146 min

    [HMN-120]90,000 Followers! The First Raw Creampie Of a Beautiful Charismatic Instagram Influencer Whose Popularity Is Still Going Up - AMu Kodama

  • amu kodama censoredcreampiebeautiful girlHMNhon nakamametaro mamezawaHMN-120HMN120hmn00120
    • 2022-02-20
    75 min

    FC2PPV 2675548 * Extra * Nogizaka-Chan [First Fit] [Seeding Supplement Plan Completed] High-Speed Piston That Does Not Stop! I Was Stunned By The Large Amount Of Ejaculation That Hung Down From The Chair …

  • amateur uncensoredfc2
    • 2022-02-24
    485 min

    [ABBA-553]This Married Woman Wanted Physical Entertainment From Me, And She Devoured My C*ck As We Had Deep And Rich, Raw Sex 30 Pairs 8 Hours 2-Disc Set

  • censoredcreampiemature womanABBAcenter villageABBA-553ABBA553h-086abba00553



    • Jav Cherry, watch JAV streaming online japanese xxx