plump




FC2WANZAUKSVENUMARAMIAARBDCESDIPXEBODONEZMEYDMIDECAWDDASDAVSASSISMILKAWDAMBISTARS

2023-02-03
108 min

300MIUM-871 A Bouncy Big Butt! Huge Breasts Swaying! I Was Also In Reiwa ... Black Gal Wild Body! ! [Plump And Toned Body X Big Burnt Ass] [Hybrid Of S And M] Sexual Technique Explosion Of Active Delivery Health Lady! ! Licking The Glans While Wrappi

  • amateur censoredcreampiebig titsmiummium-871mium871300mium-871
    • 2023-02-03
    57 min

    393OTIM-140 [Plump H Cup Beautiful Girl] Hina-Chan

  • amateur censoredcreampiebig titsotimotim-140otim140393otim-140
    • 2023-02-01
    101 min

    YMDS-127 An Explosive Wife'S Sober Married Woman'S Hidden Carnal Lust & Explosive Body! When I Took It Off, My Amazing Plump J-Cup Secretary Was So Sensitive That She Fell Into White Eyes And Fell Into A Trance Climax Seiri

  • seiri censoredYMDSmomotaro video publishingaceyoung peachYMDS-127YMDS127ymds00127
    • 2023-01-31
    45 min

    404DHT-0682 Plump Busty Wife In Her 50’s Is Covered In Cloudy Liquid Creampie Nagata-San 50 Years Old

  • amateur censoredcreampiebig titsdhtdht-0682dht0682404dht-0682
    • 2023-01-31
    137 min

    STARS-762 When I Couldn'T Control My Erection And Tried To Attack Her Older Sister In Her Defenseless Braless After Taking A Bath, On The Other Hand, Momona Koibuchi Got Screwed Over And Over Again Because She Was Super Plump And Unmistakably Insatia

  • koibuchi momona censoredsistersingle workSTARSsod createdazai chinposod starSTARS-762STARS7621stars00762
    • 2023-01-30
    75 min

    HMDNV-375 [Endorsed By Married Woman Enthusiasts] Newlywed Mom With Erotic Breasts And Plump Areolas Cuckolding A 26-Year-Old! Swimsuit Model Caught On An Expensive Part-Time Job And Doubled Her Sensitivity With Oil. I Was Thrilled To Be Poked By A R

  • censoredHMDNVhamedori.network secondeditionHMDNV-375HMDNV375h-1472hmdnv00375
    • 2023-01-28
    60 min

    FC2PPV 3176152 *Limited First Time* [J/Kei/Papa Activity/Gonzo] C Cup Plump Beauty Female Himari 18 Years Old [cen]

  • amateur uncensored
    • 2023-01-27
    69 min

    FC2PPV 3175673 [Veranda Exposure] <2 Consecutive Vaginal Cum Shots> [Nasty Plump Plump Tits Wife] M *** Perfect Hugging Feeling That Makes You Want To Stick! Pies On A Plump Body & Wearing Erotic Costume, And Sprinkling With All Power To A Sup

  • amateur uncensored
    • 2023-01-27
    76 min

    326URF-070 [Back Customs] Four Masterpieces Without! ! E Cup Fair Skin Slender & Plump Erotic Butt Beauty’s Unmatched Technique Is Too Dangerous And The Sperm Has Dried Up Www

  • amateur censoredcreampieamateururfurf-070urf070326urf-070
    • 2023-01-22
    91 min

    MAAN-838 [Pleasure Quesera Sera! Plump Beautiful Butt X Super-feeling Mass Splash Sexual Intercourse] A Super Positive Angel Who Gives Energy To The Surroundings! Best Butt & Immediate Wet Sensitive BODY! Extreme Erotic Tech That Can Blame Nipples &

  • amateur censoredcreampiesquirtingmaanmaan-838maan838maan-838
    • 2023-01-21
    131 min

    BLOR-210 The Plump Big Breasts Clerk Who Works At A Musical Instrument Store, And The Usually Classy Sister Is Super Horny, And She Cums Deep With A Big Cock And Is Totally Masochistic!

  • censoredBLORburokkori mousou zokubroccoliburokkoriBLOR-210BLOR210blor00210
    • 2023-01-20
    140 min

    ROYD-117 When I Started Rubbing My Sister'S Plump, Huge Breasts That Came Out Exposed, They Were So Compatible That They Crossed The Line. Ayase Kokoro

  • ayase kokoro censoredsingle workROYDroyallobsterhhh groupROYD-117ROYD117royd00117
    • 2023-01-20
    111 min

    VENX-194 I Got An Erection At The Shameful Appearance Of My Wife'S Mother, Who Recently Started Worrying About Her Plump Mature Figure, Shiraki Yuko

  • shiraki yuko censoredcreampiesingle workVENXvenussaruincest vi nasuVENX-194VENX194venx00194
    • 2023-01-20
    240 min

    CJOB-122 31 Best Live Sex With A Slutty Woman With Plump Nipples And A Plump Body

  • julia sayama love censoredcreampieCJOBbichijo hebun bestCJOB-122CJOB122cjob00122
    • 2023-01-20
    120 min

    JUQ-171 This Is A Story Where She Was Sexually Harassed By Her Strict, Plump Female Boss Who Was Strict With Her Subordinates And Not Only Got Mad At Her, But She Was Even Able To Have Sex. Haruna Hana

  • haruna hana censoredsingle workJUQmadonnabiba gonzoJUQ-171JUQ171juq00171
    • 2023-01-19
    154 min

    AKDL-216 Knee-High College Student Kokona Yuki Seduces Me With Her Absolute Domain Plump Thighs

  • kokona yuki censoredAKDLaquinoriaquinoriaknrAKDL-216AKDL2161akdl00216
    • 2023-01-12
    65 min

    FC2PPV 3165336 [Uncensored X Personal Photography] Husband Certified! Adultery Ok! Open Relationship Plump Wife Was Too Aggressive And Too Erotic! A Beautiful Witch Wife Who Doesn’t Look 42 Years Old Enjoys Adultery Sex ☆

  • amateur uncensored
    • 2023-01-10
    60 min

    FC2PPV 3164671 [Uncensored] [Neat And Clean X Big Breasts] Observation Of Bristle Dense Forest Pussy In Cusco, Full View To The Deepest Part Of The Uterus! Neat And Clean JD With F Cup Plump Breasts And Bath Raw Squirrel, Plenty Of Semen In The Belly

  • amateur uncensored
    • 2023-01-03
    88 min

    MAAN-830 [Yukata Beauty On The Way Home From Fireworks And Toy Abuse X Drink And SEX! Facial Specialization X Curvaceous BODY] [Dense Pacifier With Plump Flesh And Thick Chibi] [Nipple & Clitoris Obsessive Toy Attack] [Mouth, Breasts And Vagina Are C

  • amateur censoredamateurbeautiful girlmaanmaan-830maan830maan-830
    • 2023-01-01
    70 min

    534IND-100 [Individual Shooting] Plump Girl And P Activity_creampie To A Beautiful Woman With Huge Breasts Whose Cleavage Is Too Dangerous_mouth Launch

  • amateur censoredcreampieamateurindind-100ind100534ind-100
    • 2023-01-01
    61 min

    HEYZO 2950 Sex Spree With My Plump Busty Boss!! Vol.2 – Momoka Ogawa

  • amateur uncensored
    • 2022-12-31
    61 min

    FC2PPV 3157664 Cheeky But Fair-Skinned Lady-Like Plump Boobs Girl With Beautiful Eyes [cen]

  • amateur uncensored
    • 2022-12-29
    47 min

    FC2PPV 3156816 [Individual Photography] Enrolled In Kamata Handjob Shop. Colossal Breasts Plump Female College Student, Face-To-Face Production That Can Not Be Seen On Sex Sites [Hidden Shooting] *Limited Release [cen]

  • amateur uncensored
    • 2022-12-26
    40 min

    FC2PPV 3153236 ※Morinashi Privilege Available [Christmas Special Price] Unauthorized Vaginal Cum Shot! ︎ F Cup Gravure Body Screams "Damdamdamdamdam"! ! Semen Is Poured And It Falls Completely From The Womb! A Plump Nympho Woman Who Can’

  • amateur uncensored
    • 2022-12-31
    119 min

    SCD-219 The Plump Old Lady Next Door Mizue Kurosaki

  • kurosaki mizue censoredSCDrubyshakojisecret rubySCD-219SCD219scd00219
    • 2022-12-31
    131 min

    CHCH-028 Maniacs Salivate! Fishing For 1! Japan'S Plump Wife With Huge Breasts And Big Butt Plump K Cup Eri (30 Years Old)

  • censoredCHCHbreasts and mother emmanielbreasts and motherCHCH-028CHCH028chch00028
    • 2022-12-30
    64 min

    417SRYA-083 Because The Wife Next To The Big Butt And Big Boobs Sticks Out A Plump Pita Bread… Chi Piston Sex W [Mr. Kotoko, Mr. Burrun’s Runaway Big Boobs Wife]

  • amateur censoredcreampiebig titssryasrya-083srya083417srya-083
    • 2022-12-30
    65 min

    417SRYA-081 The Wife Next To The Big Butt And Big Boobs Sticks Out A Plump Pita Bread, So… Ji Po Intense Piston Sex W [Nozomi-San, Slender Big Butt Wife]

  • amateur censoredcreampiebig titssryasrya-081srya081417srya-081
    • 2022-12-30
    67 min

    417SRYA-080 The Wife Next To The Big Butt And Big Boobs Sticks Out A Plump Pita Bread, So… Ji Po Intense Piston Sex Is Just W [Yuri-San, Erotic Wife With 100 CM Outrageous Hips]

  • amateur censoredcreampiebig titssryasrya-080srya080417srya-080
    • 2022-12-30
    47 min

    417SRYA-082 The Wife Next To The Big Ass And Big Boobs Comes Out With A Pita Bread Sticking Out Plumply … Ji Po Extreme Piston Sex W [Yuna-San, A Wife With A Strong Erotic Desire With A Plump Butt Over 90cm]

  • amateur censoredcreampiebig titssryasrya-082srya082417srya-082
    • 2022-12-30
    70 min

    259LUXU-1625 Luxury TV 1643 Plump Lips And Plump Body! Sensitive Enough To Blow The Tide If You Caress The Clitoris! If You Insert A Deca ○ N Into A Honey Pot That Has Become Tororo, It Will Be Tightened And Reacted Sensitively And Disturbed!

  • amateur censoredbig titsamateurluxuluxu-1625luxu1625259luxu-1625
    • 2022-12-27
    80 min

    200GANA-2781 Seriously Flexible, First Shot. 1871 Cute L**i JD Who Followed Me To The Hotel Before I Made An Appointment With My Friend! Brilliant Pink Areolas & Plump Peachy Buttocks That Make You Happy To Take Them Off♪ (Kozue Fujita)

  • amateur censoredamateurganagana-2781gana2781200gana-2781
    • 2022-12-24
    53 min

    CRNX-092 [4K] Ntr While My Husband Is Away!! Assault Sex On The Plump Big Breasts Wife Next Door Monami Takarada

  • takarada monami censoredCRNXcrystal picturecrystal nextCRNX-092CRNX092crnx00092
    • 2022-12-23
    120 min

    JUQ-185 I Missed The Last Train, And I Continued To Be Squeezed Until Morning With No Time To Rest By My Plump Boss'S Wife, Who Had Too Much Sexual Desire. Kazama Yumi

  • kazama yumi censoredslutsingle workJUQmadonnabiba gonzoJUQ-185JUQ185juq00185
    • 2022-12-23
    100 min

    VENX-190 My Wife'S Mother, Who Has Recently Began Worrying About Her Plump Mature Woman Figure, Is Ashamed And I Got An Erection Mayu Suzuki

  • suzuki mayu censoredcreampiesingle workVENXvenussaruincest vi nasuVENX-190VENX190venx00190
    • 2022-12-23
    130 min

    GENU-001 The Supreme M Erogenous Plump Whip W Big Ass Pincer Shot Inverted 3P Harem Imekura Ass Pressure Is A Brain Bug ● Continuous Nuki Bukkake Vaginal Cum Shot Until You Get Stupid!!

  • kawakita meisa mizuki yayoi censoredcreampieslutGENUvenuspa ki kimukoultimaGENU-001GENU001genu00001
    • 2022-12-20
    99 min

    VNDS-3396 While My Plump Mother-In-Law Is Sleeping...

  • kaori takamatsu sugioka emiko censoredcreampielingerieVNDSnextnext eleven nextVNDS-3396VNDS3396h-1664vnds03396
    • 2022-12-17
    120 min

    GVH-490 His Remarriage Partner'S Natural Jd Stepson'S Unconscious Plump Lower Body Temptation Is Poppy, So Jun Suehiro Finished To Be A Ji Po Dependent Bitch With A Big Ass Push Up Demon Piston And Seeding Training

  • suehiro jun censoredcreampiesingle workGVHglory questharuka yukioGVH-490GVH490gvh00490
    • 2022-12-17
    59 min

    598HMT-019 [Fuck An Erotic Milk Apparel Clerk With A Plump Areola! ] Gonzo Sex With A Beautiful Woman Whose Smile Is Too Cute! [Apparel Clerk/Erotic Milk]

  • amateur censoredamateurhmthmt-019hmt019598hmt-019
    • 2022-12-16
    53 min

    FC2PPV 3145362 Price Cut Until Tomorrow [Creampie] [4P Orgy] Punishment Surprise F Ck For Wives Of Multiple Bonds Who Sold Their Daughters! A Certain Elite Bureaucrat’s Beautiful Wife And Plump Busty Snack Mom

  • amateur uncensored
    • 2022-12-16
    57 min

    259LUXU-1612 Luxury TV 1639 An Esthetician With A Plump And Glamorous Body Is Here! The Beautiful Big Breasts Released From The Bra Dance Bewitchingly With Pistons In Various Positions, Panting To Enjoy Her Pleasure! !

  • amateur censoredbig titsamateurluxuluxu-1612luxu1612259luxu-1612
    • 2022-12-16
    120 min

    NIMA-014 A Sensual Comic Collaboration Of 3 Plump Actresses With Huge Breasts And A Dream Spree Spree! When I Change Jobs, All Women Are Alive Hell Himesaki Hana Koume Ena Minami Momo

  • minami peach ena koume censoredcreampieslutNIMAfitchniku manNIMA-014NIMA014nima00014
    • 2022-12-16
    75 min

    300MIUM-855 Sesame Fountain! Lovely Companion [Triple Time Of Fair-Skinned Plump G-Cup X Beautiful Buttocks And Beautiful Legs] [Chubby Lips You Want To Lick] [Doskebe Puffy Nipples] Share A Seat With A Beautiful Companion Who Exposes Her Enchanting

  • amateur censoredbig titssquirtingmiummium-855mium855300mium-855
    • 2022-12-16
    31 min

    508HYK-061 Shiny With Sweat And Oil! Plump Chubby Meaty Feeling Too Erotic

  • amateur censoredamateurhykhyk-061hyk061508hyk-061
    • 2022-12-13
    32 min

    511SDK-060 [Open-Air Bath Sex] Dense Act Of Devouring The Plump Body Of A Married Woman

  • amateur censoredcreampiebig titssdksdk-060sdk060511sdk-060
    • 2022-12-12
    77 min

    YAKO-036 Mature Woman Mania Underground Shopping Mall Plump Huge Breasts Gachimuchi Mom Kazue (45 Years Old)

  • censoredYAKOmercury mercuryshinjuku undergroundYAKO-036YAKO036h-1133yako00036
    • 2022-12-11
    45 min

    FC2PPV 3143470 [Individual Shooting] Licking The Big Ass To The Anus Ueno Handjob Store Plump Huge Breasts Hidden Shooting With Professional OL Prostitutes Outflow * Amateur Appearance * Ass Pressure Is Amazing [cen]

  • amateur uncensored
    • 2022-12-02
    72 min

    259LUXU-1650 Luxury TV 1634 A Beauty Staff Member With A Plump Body That Gives Off An Adult Sex Appeal! Feel The Rich Torture With An Ecstatic Expression, Welcome The Big Cock Into The Secret Part Where The Sensitivity Is Increasing, Shake The Big Ti

  • amateur censoredbig titsamateurluxuluxu-1650luxu1650259luxu-1650
    • 2022-12-02
    120 min

    VENX-184 Rich, Plump, Brush-Down Sex With My Favorite Busty Aunt Fujiko Mio

  • fujiko mio censoredcreampiesingle workVENXvenussaruincest vi nasuVENX-184VENX184venx00184
    • 2022-12-02
    120 min

    WAAA-227 For 3 Days When My Wife Is Away, Stepchild J ● Who Is Plump, Busty, And Easy To Eat Is Vaginal Cum Shot With Kimeseku Sperm Pickled Ayase Kokoro

  • ayase kokoro censoredcreampieschoolgirlWAAAwanz factoryWAAA-227WAAA227waaa00227
    • 2022-11-30
    110 min

    522DHT-0552 [A Thick And Strong Wife With Sweat Dripping On Her Forehead! Moderate Plump Butt Shakes! Thigh Shakes! I Can’t Stand The Fleshy Body That Melts! ] Are You Mad At The Discovery Of Your Husband’s Cheating？ A T-Back Bites Into The

  • amateur censoredcreampiemarried womandhtdht-0552dht0552522dht-0552
    • 2022-11-28
    60 min

    498DDH-128 [Miss Menes Who Looks Like Her Big Breasts Are About To Pop Out Of Her Thin See-through Clothes Like Hagoromo. Plump Thighs And Buttocks Are Almost Completely Exposed, Right？ ] A Massage That Rides On The Customer And Presses The Whole Bod

  • amateur censoredcreampiebig titsddhddh-128ddh128498ddh-128
    • 2022-11-28
    56 min

    328HMDNC-535 [Flesh You Want To Impregnate] Plump Big Butt Wife 30 Years Old. A Male Esthetician Waiting For 100 People To Make A Deep Orgasm With His Virtuosity! ! Aphrodisiac Oil Is Rubbed In And A Meat Stick Massage Is A Troiki Pleasure Conceived

  • amateur censoredcreampiebig titshmdnchmdnc-535hmdnc535328hmdnc-535
    • 2022-11-28
    75 min

    HMDNV-535 [Body I Want To Conceive] A Wife With A Plump Big Butt Is 30 Years Old. Deep Climax With The Virtuosity Of A Male Esthetician Waiting For 100 Reservations!! Aphrodisiac Oil Coated With Meat Stick Massage, Conceived With Troiki Delight, And

  • censoredHMDNVhamedori.network secondeditionHMDNV-535HMDNV535h-1472hmdnv00535
    • 2022-11-27
    68 min

    259LUXU-1631 Luxury TV 1632 A Beautiful Manicurist With A Plump And Glamorous Body Appears! The Dance Of Big Breasts That Sway Bewitchingly Every Time A Piston Is Done! Pant Panting In Various Positions Behind The Big City! !

  • amateur censoredbig titsamateurluxuluxu-1631luxu1631259luxu-1631
    • 2022-11-26
    59 min

    598HMT-016 [Immediately Defeat The Unavoidable Huge Breasts Professional Student! ] A Whole Body Plump Baby-faced Beautiful Girl Who Looks Good In Uniform And Gonzo SEX! [Professional Student / Beautiful Breasts]

  • amateur censoredbig titsuniformhmthmt-016hmt016598hmt-016



    • Jav Cherry, watch JAV streaming online japanese xxx