grimosa




FC2VENUAPODVENXAMBIAUKGSTARSAUKSHDKAMIDEWAAASHKDSPRDFSDSSAVSAHZGDNACXABWIPXPREDBLK

2020-09-17
61 min

326PIZ-027 Virgin practicality guidance! !! A teacher who can not refuse is asked by a boy student and a lascivious extracurricular lesson! ？？ Teaching child-making from the pleasure of raw squirrel to vaginal ejaculation www

  • amateur censoredcreampiebig titspizpiz-027piz027326piz-027
    • 2020-09-25
    237 min

    [ASI-026]First Time Shots Married Woman 18

  • censoredamateurmature womanASIprestigekanbiASI-026ASI026118asi00026
    • 2020-09-30
    51 min

    FC2PPV 1518756 First shot ❤️ Slender body ❤️ Beautiful breasts ❤️ Nice ass ❤️ Lolita beautiful girl ❤️ I have made a vaginal cum shot for the first time in my life ~! !!

  • amateur uncensoredfc2
    • 2020-10-14
    44 min

    FC2PPV 1534208 [Idol-class looks] Mouth pussy service in a god style! Erotic blowjob face is dangerous. He sucked the cock deliciously! Of course he also showed me masturbation! !!

  • amateur uncensoredfc2
    • 2020-10-23
    69 min

    FC2PPV 1544130 ★ First shot amateur ☆ Outstanding style ♥ Fuka-chan of pre-pre-beauty BODY 21 years old ☆ Excited by the body of young Pichi Pichi ♥ Electric training of undeveloped erogenous zone ♥ Blow is rich and intense ♥ Massive vaginal cum shot

  • amateur uncensoredfc2
    • 2020-10-30
    65 min

    [OTIM-042][For Distribution Only] [Daydream Impregnation Drama] I Love Dull, Tottering Old Men! Chiharu Miyazawa

  • chiharu miyazawa censoredcreampieuniformOTIMprestigeonetimeOTIM-042OTIM042118otim00042
    • 2020-11-01
    244 min

    [NACX-066]Creampie Sex With A Woman With A Writhing Exquisite Body 14 Ladies vol. 02

  • freedom shinoda yu censoredcreampiebig titsNACXplanet plusshichidomeNACX-066NACX066h-237nacx00066
    • 2020-11-06
    114 min

    [SHKD-911]She Was Trying To Avenge Her Father, But... This Female Detective Was Captured By The Sinister Organization, And Subjected To Sex For A Year Minori Hatsune

  • hatsune minori censoredbig titssingle workSHKDattackerskinsharkSHKD-911SHKD911shkd00911
    • 2020-12-04
    480 min

    [DRC-021]Raw Footage Leaked Amateur Videos 6

  • censoredcreampiebig titsDRCprestigedocument recordDRC-021DRC021118drc00021
    • 2020-12-04
    53 min

    374SHOW-037 Mao

  • amateur censoredamateurbeautiful girlshowshow-037show037374show-037
    • 2020-12-05
    119 min

    [JUL-394]How I Wound Up Sharing A Hotel Room With My Gorgeous Boss On A Business Trip Tsubaki Kato

  • kato camellia kaoru natsuki censoredmature womansingle workJULmadonnamametaro mamezawaJUL-394JUL394jul00394
    • 2020-12-08
    126 min

    [KTRA-260]My Stepsister's Little Tits Are Making Me Horny Hinako Mori

  • hinako mori censoreduniformschoolgirlKTRAk tribeKTRA-260KTRA260h-094ktra00260
    • 2020-12-11
    53 min

    FC2PPV 1602409 ☆ Limited number of 600pt OFF! !! !! [None / Piece] The second installment of Rorikawa Chubby Student Fumina-chan! !! !! Every time I feel it in cat ear cosplay, the tin rings ♪ * There is a face-up review privilege

  • amateur uncensoredfc2
    • 2020-12-17
    99 min

    [OKSN-312]MILFs Gone Wild... Stepmoms Desperate For Their Stepsons' Cocks Ambush Them In Best! Made To Get Hard Again And Again - 2 Rounds Of Pounding

  • censoredblowjobmomOKSNabc mousouzokuokasan.comOKSN-312OKSN312oksn00312
    • 2020-12-25
    240 min

    [ENKI-032]A Horny, Terrorizing Pussy, Overflowing With Uncontrollably Lusty Pheromones Akari An Excessively Bitchy Elder Sister Type Slut Is Getting Pumped With Excessively Stored Semen In This Collection Of Creampie Raw Footage

  • censoredcreampiedeepthroatENKItoxic bacchanalENKI-032ENKI032h-1406enki00032
    • 2021-01-01
    97 min

    [MBRAA-186]遠藤美南 みなみ←透けピンク

  • endou minami censoredsoloworkMBRAAspice visualMBRAA-186MBRAA186
    • 2021-01-08
    21 min

    FC2PPV 1636749 [Prevention of body baldness, nothing] Call a certain cafe clerk to your home and ejaculate in the mouth with a rich soggy blowjob

  • amateur uncensoredfc2
    • 2021-01-30
    59 min

    C0930 hitozuma1346 Serina Saino 30years old

  • amateur uncensoredc0930
    • 2021-02-02
    42 min

    FC2PPV 1657568 [Personal shooting] Tomohame! I took a gonzo like a friend ☆ Rikako 28 years old ☆

  • amateur uncensoredfc2
    • 2021-02-05
    240 min

    [BUR-563]A Naive Beautiful Country Girl's Outdoor Obscene Mischief Video Collection, 4 Hours

  • censoredcreampiebeautiful girlBURgraysburstBUR-563BUR56312bur00563
    • 2021-02-13
    119 min

    240TOKYO-411 Sayaka

  • amateur censoredanalbig titstokyotokyo-411tokyo411240tokyo-411
    • 2021-02-16
    65 min

    SIRO-4423 [First shot] [De M thirty woman] [Screaming screaming ..] Sensitive lady who is shy about handsome guys drowns in pleasure. Was sex after a long time more pleasant than I imagined .. Application amateur, first AV shooting 193

  • amateur censoredamateursirosiro-4423siro4423siro-4423
    • 2021-02-24
    48 min

    [CSDX-006](4K) Cosplay + Aoi Kururugi 3 Aoi Kururugi

  • aoi kururugi censoredblowjobcosplayCSDXcosdeluxeCSDX-006CSDX006h-1558csdx00006
    • 2021-03-06
    119 min

    [JUL-501]I Am Bullied And Want To Fuck My Classmate's Mom Tsubaki Kato

  • kato camellia kaoru natsuki censoredmature womanmomJULmadonnajyoji kawaiJUL-501JUL501jul00501
    • 2021-03-11
    164 min

    [NTRD-088]Cuckolders This Is The Story Of How I Got Fucked Hana Haruna

  • haruna hana censoredsingle workNTRDtakara eizokouji takarashintokaiNTRD-088NTRD08818ntrd00088
    • 2021-03-19
    54 min

    328HMDN-346 [W Demon Cock 3Px Married Woman] Married Woman Aina 37 Years Old Wife Who Was Addicted To 3P With Intense Pleasure! From the top to the bottom, if you keep dying the lewd pussy of your cheating wife who is happily numb to the merciless pi

  • amateur censoredcreampiemarried womanhmdnhmdn-346hmdn346328hmdn-346
    • 2021-03-21
    65 min

    420SWEET-008 Manamofu (18)

  • amateur censoredbig titsuniformsweetsweet-008sweet008420sweet-008
    • 2021-05-14
    12 min

    FC2PPV 1767854 [Personal shooting] Izumi 18 years old, short SEX remastered version [Limited time offer]

  • amateur uncensoredfc2
    • 2021-05-20
    93 min

    [OKP-084]Riku Serina Her Jiggling And Wiggling Titties Will Ruin Any Man!! Divine Marshmallow-Flavored Big Tits God Blessed Her With A Lolita Soft Body And Dressed Her In School Swimsuits, Bloomers, And A Micro Bikini, And Granted Us The Pleasure Of

  • serina riku censoredbig titssingle workOKPdaddy s private photosgoro koenjigodly pantyhoseOKP-084OKP0841okp00084
    • 2021-07-24
    151 min

    [MCSR-443]A Slutty Apartment Wives With Colossal Tits: Beautiful, Mature Women In The Neighborhood Who Are Frustrated: Two Women Who Sleep Around

  • oda mako kiriko imato censoredbig titsmature womanMCSRbig morkalmascottMCSR-443MCSR44357mcsr00443
    • 2021-08-06
    80 min

    259LUXU-1469 Luxury TV 1440 Saffle Is Not Enough! An Active Race Queen With Slender Legs And Fascinating Big Eyes Is Here! I Smiled Happily At The Man’S Piston And Iki Many Times! Standing Back, Cowgirl, Missionary Position … This Beautiful

  • amateur censoredamateurluxuluxu-1469luxu1469259luxu-1469
    • 2021-08-14
    74 min

    523DHT-0286 Although It Looks Like An Adult, Maho, A Wife Who Is Too Erotic In The Generalized Erogenous Zone, Is 40 Years Old.

  • amateur censoredcreampiebig titsdhtdht-0286dht0286523dht-0286
    • 2021-08-18
    32 min

    FC2PPV 2039969 Limited Number! !! [Uncensored] Fornication With A Beautiful Girl Reader Model With An Idol Face! Creampie In An Outstanding Slim Body! !!

  • amateur uncensoredfc2
    • 2021-08-21
    239 min

    [OKAX-768]A Massage Parlor In Shioume Offering Handjobs That Feel Like Putting Your Cock In Pussy

  • hitomi enjo kawaon walnut censoredslutOKAXk m produceokazuOKAX-768OKAX768okax00768
    • 2021-08-21
    42 min

    362SCOH-055 [Creampie] Let A Carefully Selected Beautiful Girl Cosplay And Conceive My Child! [D] Rear 2] Rika Aimi

  • amateur censoredcreampieamateurscohscoh-055scoh055362scoh-055
    • 2021-08-21
    131 min

    [DBER-122]Female Body On The Edge Of Death Will Fall Into The Pits Of Hell Sinking Into The Hell Of Iron Chains Episode 11: After She Is Captured By The Black Demons, The Powers Of The Strongest Warrior Goddess Are Sealed And They Eat Her Up Nanako M

  • nanako miyamura censoredsingle workDBERbaby entertainmentkikubonred babeDBER-122DBER122dber00122
    • 2021-09-05
    109 min

    [IMO-010]I Order A Callgirl And My Little Sister Arrives! As A Result, We End Up Having Secret Creampie Sex 3

  • miyazaki rin hasumiten censoredcreampieblowjobIMOglayzsisterIMO-010IMO01012imo00010
    • 2021-09-10
    477 min

    [OFJE-329]Right After I After Fucked Her, I Fucked Her Again 100 Times In A Row 480 Minutes Of Women Who Are Fucked To Oblivion And Can Never Cum Back

  • yua mikami tsukasa aoi censoredbig titsbeautiful girlOFJEs1 no 1 styleOFJE-329OFJE329ofje00329
    • 2021-09-11
    55 min

    10musume 091121_01 Her Ex Made Her Believe that Sperm Needed to Be Swallowed Yui Asakawa

  • amateur uncensored10musume
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-19
    50 min

    523DHT-0296 38 Years Old Full-Time Housewife Mari-San, 38 Years Old, A Carnivorous Cheating Wife

  • amateur censoredbig titsmarried womandhtdht-0296dht0296523dht-0296
    • 2021-10-06
    51 min

    396BIG-116 Mel (Kusumi Mel)

  • amateur censoredcreampieschoolgirlbigbig-116big116396big-116
    • 2021-10-09
    108 min

    [NSFS-031]The Boss and His Wife Underling 17. A Wife Gives Into Lustful Desires At The Home Of Her Husband"s Parents. Mayuka Kitagawa

  • mayuka kitagawa censoredmature womansingle workNSFSnagae stylenagaeNSFS-031NSFS031nsfs00031
    • 2021-10-16
    120 min

    [GS-2027]True Stories - Step-Siblings [48] After that

  • sakashita maki censoredGSgo go zutakahashi kouichigosGS-2027GS2027
    • 2021-11-06
    44 min

    C0930 ki211107 Satoko Aragaki 44years old

  • amateur uncensoredc0930
    • 2021-12-11
    151 min

    [SCOP-749]The Horny Young Wife From Next Door Is Wearing A Tight Mini One Piece Dress And Using My Cherry Boy Cock Like Her Own Personal Dildo And Cumming Her Brains Out

  • censoredcreampiebig titsSCOPscoopk taromousouzokuSCOP-749SCOP749scop00749
    • 2021-12-13
    72 min

    300MIUM-766 The Apron Was Full Of [Big Breasts And Libido]! !! [A Belly Peco Metamorphosis That Opens A Cooking Class At Home And Tastes The Man’S Matsutake Mushrooms Brought In] X [A Fierce Man With More Than 100 Experienced People] X [Abnormal

  • amateur censoredcreampiebig titsmiummium-766mium766300mium-766
    • 2022-01-30
    68 min

    544IDJS-071 Mitsuha [Nampa] [Bristles] [Creampie] (Mitsuha Higuchi)

  • amateur censoredcreampieamateuridjsidjs-071idjs071544idjs-071
    • 2022-02-04
    199 min

    [TYSF-003]Shinjuku Slut Cruising! Reverse Pick Up Crazy Tour Looking For Cock In Most Crowded Place In Japan. Honoka Tsujii, Rika Tsubaki

  • tsujii honoka tsubaki rika censoredbig titsblowjobTYSFroyalmasanorihhh groupTYSF-003TYSF003tysf00003
    • 2022-02-12
    48 min

    FC2PPV 2661697 [3 Days Limited 2480 → 1980] [No / Face Exposure / Sanctions] 10 Men Teach A Nightmare With Nakadashi To A Fair-Skinned Busty Woman Who Was Tossing The Promise Of An Acquaintance. 2 Works Total 124 Minutes

  • amateur uncensoredfc2
    • 2022-02-13
    63 min

    [021322-001]Let"s get sweaty in foursome

  • mao umino uncensoredcreampiehandjobcaribbeancom
    • 2022-02-18
    120 min

    [MISM-230]The Absolute DEBUT Of A Beautiful Girl And Her Anus: Kyoka -Chan. University S*****t. 20 Years Old.

  • censoredbeautiful girlMISMm girls 039 labinaballMISM-230MISM230mism00230
    • 2022-03-08
    480 min

    [KTRA-390]The Continuous Sex Of 10 Busty Beautiful Girls 7 - 8 Hours, 2-disk Set

  • yuuri sakura shinomiya censoredcreampiebig titsKTRAk tribeKTRA-390KTRA390h-094ktra00390
    • 2022-03-08
    104 min

    [KSEG-008]Cute Little Sweetie Looks Like A Doll In A Erotic Camp Situation Makes Her Older Friend To Horny To Hold Back/Arisa

  • takanashi arisa censoredbeautiful girlsisterKSEGorustak picturesoldstack picturesKSEG-008KSEG008n-650kseg0008
    • 2022-04-07
    93 min

    OKO-001 Alice Kisaki. Amazing Tits. Everything From Big Tits To Beautiful Tits And Small Tits, Huge Nipples And Areola, Drooping Tits And Skinny-chested Tiny Tits, Barely Legal Tits As Well As Tits On Mature Women And Ladies. There"s A Huge Varie

  • kisaki alice censoredcreampiebig titsOKOpersonal photography of fathergod boobsOKO-001OKO0011oko00001
    • 2022-04-16
    75 min

    H4610 ki220417 Mia Aoki 22years old

  • amateur uncensoredh4610



    • Jav Cherry, watch JAV streaming online japanese xxx