fair skinned




FC2GVHGMEMFSDSSPREDMVSDHNDHDKAMIDVRBDADNMIDEVENXBLKJULVEMAROYDSHKDAMBIAUKGHODV

2020-12-28
16 min

10musume 122820_01 Secret Pussy Collection: Arika Funaki

  • amateur uncensored10musume
    • 2021-01-07
    92 min

    AVKH-189 Shiori Sawada

  • amateur censoredbig titsamateuravkhavkh-189avkh189avkh-189
    • 2021-01-08
    217 min

    [SW-749]I Became a Teacher In Order To Have Sex With Cute Female S*****ts! 11

  • censoredbig titsschoolgirlSWswitchswitch switchSW-749SW7491sw00749
    • 2021-01-14
    92 min

    [XMOM-027]Dick-Hungry Wealthy Wife Gobbles Cock! Reina Sawada

  • rena sawada censoredcreampiemature womanXMOMcenter villageamakumopink sighXMOM-027XMOM027h-086xmom00027
    • 2021-01-28
    60 min

    H0930 ki210128 Saeko Hamaoka 28years old

  • amateur uncensoredh0930
    • 2021-02-04
    69 min

    413INST-093 [Personal shooting] I tried to verify how far I would go if I had a personal photo session with an 18-year-old amateur J layer. 【amateur】

  • amateur censoredcreampieschoolgirlinstinst-093inst093413inst-093
    • 2021-02-05
    28 min

    FC2PPV 1673526 Main story appearance Creampie in a beautiful campaign girl! Highleg x glossy pantyhose x stiletto heels Exquisite body and nice ass girlfriend in a pita pita leotard

  • amateur uncensoredfc2
    • 2021-02-08
    73 min

    259LUXU-1380 Luxury TV 1363 A beautiful violinist is back! “I like him, but … I want to experience more with other men.” Dress in a bikini that accentuates the beauty slender style, and accept the big cock in the moist secret part, and

  • amateur censoredamateurluxuluxu-1380luxu1380259luxu-1380
    • 2021-02-11
    124 min

    [FSDSS-169]Stepsisters Yume & Momo's Passionate Sex Life Yume Nikaido Kaname Momojiri

  • nikaido yume kaname momojiri censoredbig titsschoolgirlFSDSSfalenosatoshi maedafaleno starFSDSS-169FSDSS1691fsdss00169
    • 2021-02-26
    118 min

    [GNAX-046]Nympho Wives Screaming In Pleasure In The Middle Of The Day - Filthy Fertility Massage They Can't Tell Their Husbands About - Mao Hamasaki

  • hamazaki mao censoredcreampiebig titsGNAXnagiranagira kenzoGNAX-046GNAX046h-1345gnax00046
    • 2021-03-06
    61 min

    1Pondo 030621_001 Working Woman: Raw Saddle Creampie in Dogeza Reika Kudo

  • amateur uncensored1pondo
    • 2021-03-11
    50 min

    Pacopacomama 031121_445 Horny Wife Helps to Lose Younger Boy’s Virginity 2 Kanon Mikoshiba

  • amateur uncensoredpacopacomama
    • 2021-03-25
    125 min

    [SW-765]Wanna Fuck A S********l？ You're So Naughty... But I'm Even Naughtier. She Changed Into Her School Uniform Track Suit And Let Me Pound Her Tiny Pink Pussy!

  • censoreduniformSWswitchswitch switchSW-765SW7651sw00765
    • 2021-04-10
    45 min

    H4610 tk0032 Takako Iimi 20years old

  • amateur uncensoredh4610
    • 2021-04-11
    95 min

    300NTK-551 Take a look at the sexual desire explosion of Echikawa beauty with a big butt! !! Picking up a beautiful woman at dawn found in Roppongi! !! The body of a beautiful woman who is tired and has sexual desire is in a state of sensitivity MAX

  • amateur censoredcreampiebig titsntkntk-551ntk551300ntk-551
    • 2021-04-12
    240 min

    [MQSM-004]The Cruel And Shameful Orgasms Of A Young Maiden - The Legendary Orgasm Files - Young Barely Legal Babes Are Pumping Out Dangerous Fragrances From Their Young, Budding Vaginas

  • censoredMQSMmercuryecstasyMQSM-004MQSM004h-1133mqsm00004
    • 2021-04-18
    240 min

    [BRTM-024]Infinite Cumming: Tied Up And Fully Restrained Female Bodies

  • censoredBRTMkm produceblack realBRTM-024BRTM024brtm00024
    • 2021-04-18
    120 min

    [GBSA-067]Filming Trip - Mimika Toda

  • mika toda censoredsingle workGBSAgogos black mousouzokukoichi takahashigogosGBSA-067GBSA067gbsa00067
    • 2021-05-07
    545 min

    [LXV-021]【期間限定販売】【MGSだけのおまけ映像付き 65分】ラグジュTV×PRESTIGE PREMIUM 19 オトナのエロさここに極まる！美女達の本当の姿を余すところなく全部見せます！！

  • amateur censoredsquirtingamateurlxvlxv-021lxv021lxv-021
    • 2021-05-19
    104 min

    428SUKE-072 [Nasty black glow gal 3P] NATSUKI-chan ★ 3P continuous sex with brilliant rolling! !! Beautiful physical beauty of dancers! Declaration of permission for vaginal cum shot "drinking pills"! I can’t stop drinking alcohol while

  • natsuki censoredcreampieamateursukesuke-072suke072428suke-072
    • 2021-05-20
    225 min

    [HAWA-248]She's Having Sex Behind Her Husband's Back "The Truth Is, I've Never Even Drank My Husband's Cum" She's Over 30 And D***king Cum For The First Time She's Always Hiding Her Perverted Desires From Her Husban

  • censoredsquirtingdeepthroatHAWAcosmos eizohawai nagasecosmospictures soft on demandHAWA-248HAWA2481hawa00248
    • 2021-05-21
    130 min

    [HZGD-189]"The Truth Is, Your Step Father Fucks Me Every Week On Tuesday" An Sasakura

  • an sasakura censoredcreampiebig titsHZGDmarried woman flower garden theaterhirokoji osakiimage married woman flower garden theatHZGD-189HZGD189h-1100hzgd00189
    • 2021-05-22
    65 min

    Pacopacomama 052221_480 Buy Your Underwear: Pussy slip t-back Junko Kunida

  • amateur uncensoredpacopacomama
    • 2021-05-28
    147 min

    [MIAA-439]These Two Gal Babe S*****ts Of Mine Were Held Back A Year And Kept Hitting Me With Demonic Blowjob Cum Swallowing Furious Piston-Pounding Cowgirl Creampie Slut Sex Until I Lost My Mind AIKA REMI

  • aika remi censoredcreampieblowjobMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-439MIAA439miaa00439
    • 2021-06-01
    120 min

    [NACR-432]The House Where The Bra-less And Panty-less Manager Gets Shared Around Miho Tono

  • miho tsuno censoredcreampieblowjobNACRplanet plusdirector onanakuruNACR-432NACR432h-237nacr00432
    • 2021-06-04
    157 min

    [BBAN-329]Sparks Ignite Between Friends And Roommates - These Lesbian Babes Are Stuck Together In Lockdown, And This Inflames Passions They Can No Longer Resist Until They Give In To Orgasmic Lesbian Sex Mikako Horiuchi Nene Tanaka

  • mikako horiuchi nene tanaka censoredlesbianBBANbibianBBAN-329BBAN329bban00329
    • 2021-06-20
    76 min

    [KAZK-063]I Ordered A Masseuse For My Step Grandmother For Her Birthday And Asked Him To Give Her A Sexual Massage... Toyo Nozawa (62)

  • nozawa notoyo censoredmature womansingle workKAZKstar paradisekazokuKAZK-063KAZK063h-254kazk00063
    • 2021-06-25
    47 min

    FC2PPV 1886293 [No] [Complete appearance] 22-year-old Faculty of Law Ai-chan Appearance that violates the law for money Conceived by a beautiful law student and vaginal cum shot [* Blow (mouth ejaculation) & undressing / shower hidden shooting ben

  • amateur uncensoredfc2
    • 2021-07-02
    213 min

    [HUNTB-048]My Sister-In-Law Is Always Waiting For My Big Brother To Come Home After Working Overtime, Late Into The Night, And Since She's Super Horny, I'm Always Fucking Her Brains Out For 8 Hours At A Time Until He Returns Home. 2

  • censoredcreampieblowjobHUNTBhunterkawajirihhh groupHUNTB-048HUNTB048huntb00048
    • 2021-07-09
    131 min

    FC2PPV 1912235 [No individual shooting, apt outflow, active underground idol sold to the dark route] It is a tragedy of a god-class high-class Lori beautiful girl. The body baldness will be deleted immediately. Please purchase only those who like it

  • amateur uncensoredfc2
    • 2021-07-31
    215 min

    [SORA-326]Blow Job Friends, Cum Swallowing J-Style Date Natsu Tojo

  • natsu tojo censoredschoolgirlblowjobSORAyama to soradenchuuSORA-326SORA326sora00326
    • 2021-08-20
    118 min

    [DASD-906]Embarrassing Yet Arousing Bathtime. Nephew Bathes With His Aunt For The First Time In Years. Starring Morisawa Kana

  • kana morisawa kanako iioka censoredcreampiesingle workDASDdasmishima rokusaburoDASD-906DASD906dasd00906
    • 2021-09-17
    119 min

    [MEYD-702]60 Days Abstinence Project! Restraint And Intense Orgasm! Her Patience Ran out And She Became Sexually Deranged While Restrained! Outrageous Male-hunting Lady SEX! Sakura Misaki

  • cape sakura censoredcreampieslutMEYDtameike gorokindaichishougo rouMEYD-702MEYD702meyd00702
    • 2021-10-02
    74 min

    200GANA-2552 Seriously Nampa, First Shot. 1698 Severe Pain Fishing Plan To Have You Walk On The Foot Pot Mat! When I Guide My Sister Who Got Caught In Ebisu To The Studio And Try To Do Erotic Things With A Massager …？ (Mitsuki Okina)

  • amateur censoredamateurganagana-2552gana2552200gana-2552
    • 2021-10-13
    63 min

    FC2PPV 2340500 【Half! Super Air Pay Festival] Teenage Girls In The Public Volleyball Club ○ Raw G-Cup Beautiful Girls. She Is A Sensitive Body That Repeats Cums Many Times. She Rubs Her Big Tits And Releases Hot Sperm Twice! In Addition, A Handjob Bl

  • amateur uncensoredfc2
    • 2021-10-13
    54 min

    229SCUTE-1138 Asuka (21) S-Cute No Bra Girl And Creampie Etch (Asuka Momose)

  • amateur censoredcreampieamateurscutescute-1138scute1138229scute-1138
    • 2021-10-22
    125 min

    [ZKWD-019]After School Cum Dumpster #19, Yuzu Saijo

  • saijo yuzu censoredcreampiebig titsZKWDtoyohikozarakiyasushiun kaiZKWD-019ZKWD019zkwd00019
    • 2021-10-24
    43 min

    553APLT-003 Sora (Hana Misora)

  • amateur censoredbig titsuniformapltaplt-003aplt003553aplt-003
    • 2021-10-29
    121 min

    [WAAA-115]Hot And Horny Female Boss Gets Wrapped Up In A Sexy Room Sharing Reverse NTR Cheating Scenario. Soft Tits And Big Ass For Creampie Fucking Till Morning, Getting 10 Shots Of Cum From Me... Hikari Kisaki

  • hikari hime censoredcreampiebig titsWAAAwanz factoryWAAA-115WAAA115waaa00115
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-25
    117 min

    [SPRD-1488]Surrogate Mother Hana Haruna

  • haruna hana censoredcreampiemature womanSPRDtakara eizosanpei suminekoaleddinSPRD-1488SPRD148818sprd01488
    • 2021-12-10
    36 min

    FC2PPV 2507138 ★ New Sale [Boobs Youtuber Suzukano Training Plan] [Titty Fucking / Blowjob] Suzukano Fucking Bride Training! ？？ [Suzuka-Chan]

  • amateur uncensoredfc2
    • 2021-12-11
    48 min

    H4610 ki211212 Nami Fujioka 27years old

  • amateur uncensoredh4610
    • 2021-12-21
    61 min

    [122121_574]万引き主婦の結末

  • amateur uncensoredpacopacomama
    • 2021-12-22
    70 min

    435MFC-169 [Superb Constriction Erotic Body X Squirting Continuous Acme] "I’m Pregnant ///" Big Breasts & Big Butt Style Outstanding Shaved Beauty And Unplanned Creampie Etch ♪ Cum! Squirting! Flood! Body Fluid-Covered Bichabicha Full

  • amateur censoredcreampiebig titsmfcmfc-169mfc169435mfc-169
    • 2021-12-23
    130 min

    [MESU-092]Overtime Sex With Old Female Boss. Creampie Office. Reiko Seo

  • reiko seo censoredcreampiemature womanMESUcenter villagejiro fukagawared snowMESU-092MESU092h-086mesu00092
    • 2022-01-15
    55 min

    C0930 gol0169 Reika Yoneda 38years old

  • amateur uncensoredc0930
    • 2022-01-25
    61 min

    1Pondo 012522_001 A Bride Who Is Trained In Anal Development By Her Father-In-Law Aisa Tamano

  • amateur uncensored1pondo
    • 2022-01-27
    123 min

    [RCTD-448]Big Titted Hermaphrodite: Reverse Bunny - Miki Shiraishi

  • miki shiraishi censoredbig titssingle workRCTDrocketroute yamazakiRCTD-448RCTD4481rctd00448
    • 2022-01-27
    158 min

    [FSDSS-384]After 5 Years, This Fresh Face Finally Decided To Make Her AV Debut - Natsu Igarashi

  • igarashi natsu censoredblowjobbeautiful girlFSDSSfalenoskyscraperfaleno starFSDSS-384FSDSS3841fsdss00384
    • 2022-02-11
    119 min

    [MEYD-740]I"m Actually Fucking My Husband"s Boss... With Hana Shirato

  • white peach censoredcreampiesingle workMEYDtameike goronaveMEYD-740MEYD740meyd00740
    • 2022-02-17
    71 min

    [REBD-628]Umi, No. 2. Light Blue Utopia And Umi Yatsugake

  • yakake umi censoredsingle workREBDrebeccazack araiREBD-628REBD628h-346rebd00628
    • 2022-03-09
    82 min

    469G-652 Imadoki Girls’ Yen Relations (Papa Katsu) Circumstances! Miona (Miona Kotoha)

  • amateur censoredcreampieuniformgg-652g652469g-652
    • 2022-03-12
    152 min

    [SORA-370]Hardcore Outdoor Sex. Big Tits Irresistible on SNS! One In A Million Opportunity To Enjoy Delicious H Cup Tits For An Extreme Outdoor Fucking Session.

  • censoredbig titsSORAmountain and sky delusion grouphimrockmountains and skySORA-370SORA370sora00370
    • 2022-03-09
    51 min

    FC2PPV 2707216 [None] [Limited To 50 Pieces 980pt!] G Cup With A Height Of 148 Cm And A Bust Of 90 Cm ♥ Petite And Glamor Body ♥ Again, Facial Cumshots And Vaginal Cum Shot 2 Times! Too Erotic ♥ Cho Sensitive Body Rolls Up Continuously! * Review Bene

  • amateur uncensoredfc2
    • 2022-02-06
    36 min

    SKHO-027 Rion (Somi Rion)

  • amateur censoredcreampieamateurskhoskho-027skho027skho-027



    • Jav Cherry, watch JAV streaming online japanese xxx