affair




FC2HNDSTARSAUKSHZGDHUNTBRBDAWDMIDVNNPJSQTEVENXNGODJUFESPRDHDKAMILKMVSDAVSAMIDEMEYD

2021-01-01
57 min

324SRTD-0206 An impressively beautiful G-cup sister contacted me because she wanted to try it with an AV actor

  • amateur censoredbig titsamateursrtdsrtd-0206srtd0206324srtd-0206
    • 2021-01-03
    105 min

    300MIUM-661 [Sweet SEX and lightning climax] Rent a super beautiful leg slender active model as her! Completely REC the whole story that was spoiled up to the originally prohibited erotic acts by persuading! !! After enjoying a date in Yokohama, Icha

  • amateur censoredcreampieamateurmiummium-661mium661300mium-661
    • 2021-01-04
    35 min

    396BIG-095 Hinako

  • amateur censoredcreampieamateurbigbig-095big095396big-095
    • 2021-01-06
    59 min

    [sika-014]あーちゃん 2(18)

  • amateur censoredbig titssquirtingsikasika-014sika014sika-014
    • 2021-01-10
    45 min

    FC2PPV 1639483 [Sold out for the first time] A modern child who enjoys H at his own pace ❤️❤️ I have put out plenty of clumped sperm ❤️❤️

  • amateur uncensoredfc2
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-02-11
    39 min

    [ore-751]アユミ

  • amateur censoredcreampiebig titsoreore-751ore751ore-751
    • 2021-02-12
    315 min

    [SUPA-569]首都圏素人女子大生 5

  • censoredamateurblowjobSUPAs kyuu shiroutoSUPA-569SUPA569h-244supa00569
    • 2021-02-18
    118 min

    [PPPD-904]This 19-Year-Old Babe Just Arrived, And Brought Her Sanshin With Her From Okinawa To Tokyo! An H-Cup Big Tits Island Girl Is Making Her Adult Video Debut Iya Sa Sa! Karen Yuzuriha

  • karen kaede censoredbig titsamateurPPPDoppaiPPPD-904PPPD904pppd00904
    • 2021-02-22
    116 min

    [MGMJ-048]Beautiful Legs In Pantyhose - Wakana Shiroyama

  • shiroyama wakana censoredslutsingle workMGMJmegamibeautyMGMJ-048MGMJ048mgmj00048
    • 2021-02-26
    99 min

    504TNNN-002 Yuki-chan

  • amateur censoredbig titsamateurtnnntnnn-002tnnn002504tnnn-002
    • 2021-02-28
    240 min

    [XVSR-582]Yui Hatano GOLDEN BEST 20 Works X 4 Hours

  • yui hatano censoredcreampiedramaXVSRmax amax ikacalenXVSR-582XVSR582xvsr00582
    • 2021-03-12
    240 min

    [SOUD-034]Amateur Girls Have Their Pussies Filled With Cum! Hot And Rough Raw Sex

  • censoredcreampieamateurSOUDprestigestrongest chome chomeSOUD-034SOUD034118soud00034
    • 2021-03-13
    151 min

    [IPX-628]Creampie SEX Revealed Momo Sakura

  • sakura sky momo censoredcreampiebig titsIPXidea pocketusa pyondishIPX-628IPX628ipx00628
    • 2021-03-14
    26 min

    FC2PPV 1725967 A 〇 Ren-Taiho 〇 Cosplay Saddle ♥ Feeling Blow and Horse Riding Fucking Service ♪ Finally, Ejaculation in the vagina with W piece! [Review benefits available]

  • amateur uncensoredfc2
    • 2021-03-18
    117 min

    [MVSD-459]A Horny And Meaty Snack Bar Mama Is Dripping With Pussy Juices As She Hits Me With A Fantastic, Flesh Fantasy Cowgirl Piston-Pounding Fuck She's Full-On Dripping And Moaning For Her Lover's Stepson As They Engage In A Youthful Cock-

  • chitose in the evening censoredbig titsslutMVSDm s video groupMVSD-459MVSD459mvsd00459
    • 2021-03-23
    139 min

    [SDJS-110]What A Rush! New Employee With A Cute Butt Nakayama Takes A Quickie From A Huge Cock - 4 Full Fucks! Her 1st Year As An SOD Female Employee Kotoha Nakayama

  • kotoba nakayama censoredsquirtingamateurSDJSsod createdainanasod female employeeSDJS-110SDJS1101sdjs00110
    • 2021-03-24
    79 min

    376H-620 Bondage Innocent Uniform Girls ●● Squid With SEX! ＃ Shizuku ＃ 18 years old

  • amateur censoredcreampieuniformhh-620h620376h-620
    • 2021-04-03
    60 min

    [040321_001]グラマラス 小島さくら

  • amateur uncensored1pondo
    • 2021-04-17
    71 min

    355OPCYN-162 Lemon

  • amateur censoredamateurbeautiful girlopcynopcyn-162opcyn162355opcyn-162
    • 2021-04-18
    260 min

    [APAE-068]Getting Off For 260 Minutes On Nene Tanaka!

  • nene tanaka censoredcreampiebig titsAPAEaurora project annexh nasuyukiaurora project exAPAE-068APAE068apae00068
    • 2021-04-20
    90 min

    [FUFU-199]True Stories Experience With Infidelity: None We Deceived This Prim And Proper Wife By Asking Her To Go Visit A Friend And Give Him Some TLC, And Then We Left Them Alone So That He Could Seduce Her, And Then ... Aira Sonokawa (34)

  • aira sonokawa censoredbig titsamateurFUFUstar paradisefufuFUFU-199FUFU199h-254fufu00199
    • 2021-04-27
    116 min

    [GONE-033]This Seriously Voluptuous Tanned Girl Is So Awesome, She's Gonna Make Me Cum Like A Rocket! An Appropriately Tall Girl (165cm) With An Appropriate Amount Of Muscle Tone And A Healthy, Erotically Tanned Body This Elder Sister Type Has Tr

  • takarada monami censoredcreampiebig titsGONEmercurybirdman teppeian erotic tanned elder sisterGONE-033GONE033h-1133gone00033
    • 2021-05-07
    120 min

    [EBOD-823]Ginza's No. 1 (Famous High-Class Club) H-Cup Hostess - Her First Ever Creampie, First Raw Cock, First Carnal Awakening! 3 Intense, Orgasmic Fucks Mina Kitano

  • mina kitano censoredcreampiebig titsEBODe bodyichigoharaEBOD-823EBOD823ebod00823
    • 2021-05-27
    117 min

    [TOEN-042]My Neighbor Is An Out-Of-Work Man Who Pumped His Cock Into Me During A Jog, And Although I Try To Live A Healthy Life To Keep My Skin Looking Fresh And Young, I Descended Into The Madness Of Orgasmic Pleasure Mitsuyo Shono

  • mitsuyo ikuno censoredcreampiemarried womanTOENcenter villageyoichi sanotaoyuanTOEN-042TOEN042h-086toen00042
    • 2021-05-28
    80 min

    FC2PPV 1841460 An overwhelming angel who has landed on the ground. He was 18 years old just after graduation when he was an idol. She is an innocent girl who is healed only by her voice. She couldn’t stand it 3 minutes after insertion and made a

  • amateur uncensoredfc2
    • 2021-06-26
    160 min

    [LULU-080]I Fucked My Big Titty Older Boss Until I Got Her Pregnant While The Two Of Us Were Alone After Work Hana Haruna

  • haruna hana censoredcreampiebig titsLULUlunaticsluminaxLULU-080LULU080lulu00080
    • 2021-07-02
    104 min

    [ADN-328]Sweaty Noon Fucking With A Sexually Frustrated Married Woman - Tsumugi Akesato

  • akari tsumugi censoredsingle workADNattackersnaotootona no dramaADN-328ADN328adn00328
    • 2021-07-08
    74 min

    ION-091 Kaori

  • amateur censoredbig titsamateurionion-091ion091ion-091
    • 2021-07-08
    92 min

    [IENF-152]Sexual Feelings Of Sensitive Girls At An Oil Massage Parlor

  • hina hotaka takanashi arisa censoredcreampieIENFie nergyienfIENF-152IENF1521ienf00152
    • 2021-07-09
    151 min

    [MIFD-169]In a Shared Room Returning From an Idol Event, To Manage the Stress From Being Banned From Romance, She Fucks and Gets Creampie Sex with the Producer Until Her Libido is Eliminated. Ami Yozora

  • ami yozora censoredcreampiebeautiful girlMIFDmoodyznabemoodyz freshMIFD-169MIFD169mifd00169
    • 2021-07-13
    129 min

    [KIRE-042]Celebrity Yume Nanase: Her First Experience Special, 34 Years Old

  • nanase yume censoredslutsingle workKIREsod createryo inugamibeauty kirei sodKIRE-042KIRE0421kire00042
    • 2021-07-16
    61 min

    FC2PPV 1925457 * Weekend Limited 3980⇒2980pt ★ First Shot ☆ Neat And Clean God Milk Slender Beauty Body Active Jd Asuka-Chan 20 Years Old ☆ Continuous Iki To Blame The Pussy ♥ Iron Man Girl Who Writhes In A Fierce Thrust ♥ Beautiful Breasts Shaking G

  • amateur uncensoredfc2
    • 2021-07-17
    123 min

    [HMN-018]What？ Cumming with just a Nipple Touch？ No Hands Fondling Makes Her Cum Hard! No Need for this Girl to Calm Down After Cumming Before Getting Creampied. Minami Hatsukawa

  • hatsukawa minami censoredcreampieslutHMNhon nakasamoariHMN-018HMN018hmn00018
    • 2021-07-17
    49 min

    H0930 ki210718 Nagisa Sakura 23years Old

  • amateur uncensoredh0930
    • 2021-07-23
    58 min

    [asgm-012]さり

  • amateur censoredcreampieuniformasgmasgm-012asgm012asgm-012
    • 2021-07-30
    236 min

    [HUNTB-063]Fucking Anyone As Much As They Want For Cash! Hospital Edition 2 If You Pay A Fixed Monthly Fee, You Can Fuck Any Female Stuff Or Patient In The Hospital As Much As You Want!

  • censorednurseHUNTBhuntermorikihhh groupHUNTB-063HUNTB063huntb00063
    • 2021-08-07
    63 min

    SIRO-4589 [First Shot] [Knowledged Neat Beauty] [Superb Blowjob Who Likes Service] A Beautiful Breasted Woman Who Is An Active Tutor Descends. Her Sexual Experience Is Thin, But Her Potential Is A Deep No-Hand Blow Job Exploding And Playing With A Co

  • amateur censoredamateursirosiro-4589siro4589siro-4589
    • 2021-08-20
    141 min

    [JUL-683]"Hey, Are You Really A Virgin？" This Married Woman Keeps Getting Fucked By Pretending To Be A VirginHX\

  • rena shiraishi censoredbig titsmature womanJULmadonnatomitake taroJUL-683JUL683jul00683
    • 2021-09-01
    134 min

    [GVH-282]A Woman Possessed With Exhibitionist / G*******g / Bukkake Desires Rin Miyazaki

  • miyazaki rin censoredslutsingle workGVHglory questusubashi suiGVH-282GVH28213gvh00282
    • 2021-09-04
    130 min

    390JAC-109 [Super Sex Brain X Big Breasts G Cup X Squeezing Cowgirl] “I Can’T Be Satisfied With Just 3 Minutes!” Libido Explodes In Too Short Sex! Squeeze 7 Pos At The Woman On Top Posture! Iki Tide & Climax Peeing All Over The Roo

  • amateur censoredcreampiebig titsjacjac-109jac109390jac-109
    • 2021-09-09
    130 min

    [CHN-208]新・絶対的美少女、お貸しします。 107 安藤もあ (AV女優) 23歳。

  • amateur censoredamateurchnchn-208chn208chn-208
    • 2021-10-07
    341 min

    [NHDTB-584]Don"t Make A Sound 25. S********l With Matured Nipples Gets Fucked Endlessly. 2-Volume Special.

  • censoredsquirtingschoolgirlNHDTBnatural highitaka sumithrin powderNHDTB-584NHDTB5841nhdtb00584
    • 2021-10-08
    145 min

    [IPX-735]A New Female Employee Is Made To Cum Over And Over Again By Her Adulterous Boss In A Shared Room NTR At A Business Trip. Kotoyumi Ono

  • kotoyumi ono censoredblowjobsingle workIPXidea pocketmaeda bungoutissueIPX-735IPX735ipx00735
    • 2021-10-08
    229 min

    [TSP-447]Women Who Were Targeted By Perverts! Stun Gun Shame I"ll Suck On Your Cameltoe For You ...

  • censoredcreampieTSPtoukyou supesharugroupTSP-447TSP447tsp00447
    • 2021-10-24
    63 min

    413INST-177 [Fortune-Telling Nampa 3] Big Breasts Cow Boobs ♀ Big Breasts Glasses Ol & Abdominal Muscle Bakibaki Ol Muscle Man’s Seeding Pistons Raging Demon Acme! Creampie Orgy Personal Shooting Of Dirty Juice Injection (Sachiko Hachino Tsub

  • amateur censoredcreampiebig titsinstinst-177inst177413inst-177
    • 2021-11-06
    70 min

    318LADY-391 Mikan (Shizuka Takano)

  • amateur censoredbig titsamateurladylady-391lady391318lady-391
    • 2021-11-13
    124 min

    [APNS-264]Going Down For One I Love. Uika Noa Girl Who Went Into Underground Sex Industry For Good For Nothing Senior.

  • squid censoredcreampiesingle workAPNSaurora project annexnasu yukihiroAPNS-264APNS264apns00264
    • 2021-11-20
    182 min

    [ROOM-031]NS #DMABeautifulGirl

  • censoredcreampieamateurROOMhomeroom homeroom mousozokuROOM-031ROOM031room00031
    • 2021-11-22
    26 min

    FC2PPV 2454087 * Limited Time 1930pt → 930pt [Uncensored / Creampie] Young Wife With Outstanding Style And W Affair. Put On The Dress That My Wife Was Trying To Throw Away And Seed It

  • amateur uncensoredfc2
    • 2021-12-03
    165 min

    [DVDMS-745]Ordinary Couple Hidden Camera Footage AV Following A Teacher And S*****t After Fucking During A One-On-One Lesson Special College Girl Home Tutor With Big Tits Pops The Cherry Of Her S*****t With Gentle Cowgirl Riding! Without Pulling Out

  • censoredcreampiebig titsDVDMSdeepspoolsideDVDMS-745DVDMS745dvdms00745
    • 2021-12-11
    129 min

    [SITW-038]Going to Seduce A Married Russian Call Girl And Creampie Her Raw. Want To Impregnate Her With Half Japanese C***d!

  • ella reese maxim law censoredcreampieSITWsuparutan mousou zoku inta nashonaruspartansSITW-038SITW038sitw00038
    • 2022-01-14
    123 min

    [BOBB-330]Exquisite I-Cup Titties x Big Tits Boin Momo Minami Boxed Set Fondle, Lick, Slurp, And Jiggle And Wiggle Those Titties To Your Full Satisfaction In A Full Course Of Titties! You Won"t Want To Miss This Epic Of Wraparound Titties In A Fu

  • minami peach censoredbig titssingle workBOBBabc mousouzokuboinbb abcBOBB-330BOBB330bobb00330
    • 2022-01-14
    123 min

    [FOCS-046]Gorgeous Big Tits F-cup Cosplayer Gets Super Horny! Her Pussy Gets Wet And Excited After Realizing It"s A Risque Photo Shoot! "I"ll Be A Cosplayer That"s Just For You!" In Akihabara. Mei Mizuki

  • mei mitsuki censoredbig titscosplayFOCSabc mousouzokufocusFOCS-046FOCS046focs00046
    • 2022-01-18
    27 min

    FC2PPV 2602585 Prefectural Ordinary Course (2) First Vaginal Cum Shot Of A Child Who Works Part-Time At A Frequently Visited School * Until Today

  • amateur uncensoredfc2
    • 2022-02-08
    51 min

    [HEYZO-2714]Reina Mizuki A Prank To A Slender MILF

  • reina mizuki uncensoredcreampieheyzo



    • Jav Cherry, watch JAV streaming online japanese xxx