yuma asami




FC2JULAMBIGMEMNACXJUFEPPPDSSISSANHDKACESDATIDWAAAMARAAPODNATRBLKGVHADNRBDKSBJ

2020-09-11
233 min

[DSS-217]Amateur Young Teen Pick Up Get!! No. 217 Sexy Stylish And Cute Girls In A Great Mood Sexual Training Online Edition

  • censoredschoolgirlamateurDSSmomotaro eizodukelady huntersDSS-217DSS217dss00217
    • 2020-09-12
    126 min

    [MIAA-318]A Brain Bug Panic! A Twitching And Trembling Cock-Scrambling Unlimited Ejaculation Fuck Fest! An Excessively Crude Honey Soapland Trance Fuck Shuri Hazuki

  • hazuki shuri censoredbig titssingle workMIAAmoodyzsamoarieveryone s porn starMIAA-318MIAA318miaa00318
    • 2020-09-18
    150 min

    [VIDA-008]When I Called A VIP Exclusive Luxury Married Woman With A Beautiful Ass, The Person Who Came Was This Madonna I Had Been Obsessed With In Class, A Long Time Ago 08

  • censoredcreampieamateurVIDAvenusmature premiumVIDA-008VIDA008vida00008
    • 2020-09-21
    47 min

    230ORETD-743 Hina

  • amateur censoredcreampieuniformoretdoretd-743oretd743230oretd-743
    • 2020-09-24
    52 min

    [MASE-002]配信限定 四十路マダム 三雲ゆり子

  • yuriko mikumo censoredcreampiebig titsMASEcrystal imagetakeshi matsudairamadam maniac plusMASE-002MASE00249mase00002
    • 2020-10-11
    120 min

    [CESD-935]175cm Tall Beautiful WOman Covered With Oil All Over Her Body, Sex With A Huge Dick - Ema Shiiba

  • emma shiiba censoredmature womansingle workCESDceleb no tomoCESD-935CESD935cesd00935
    • 2020-10-15
    241 min

    [PYM-353]Self Shots Unequaled Libido - Finger Pussy Insertion, Going Crazy Cumming And Masturbating

  • censoredsquirtingPYMprimoPYM-353PYM353h-283pym00353
    • 2020-10-17
    138 min

    [SSNI-900]Mixed Body Fluids, Deep Sex - Completely Uncut Special Riri Nanatsumori

  • nanatsumori riri censoredsingle workSSNIs1 no 1 stylemon cSSNI-900SSNI900ssni00900
    • 2020-10-19
    44 min

    305TRUMG-127 Midori

  • amateur censoredamateurtrumgtrumg-127trumg127305trumg-127
    • 2020-11-22
    161 min

    [CJOD-269]Oral Sex Gal Massage Parlor "I'll Lick And Suck Your Cock, Balls, And Ass Until They're Swollen" Hina Nanami

  • hina nanami hina nanase censoredblowjobsingle workCJODchijo heavenkogoro kindaichiCJOD-269CJOD269cjod00269
    • 2020-11-22
    119 min

    [HND-915]My Classmate Confided In Me About Her Boyfriend's Premature Ejaculation Problem So I Started Fucking Her, And 5 Minutes In She's Already Lost In Pleasure Wrapping Her Legs Around Me Tight - Rin Kira

  • kira rin censoredcreampieblowjobHNDhon nakatiger kosakaiHND-915HND915hnd00915
    • 2020-11-30
    61 min

    FC2PPV 1585937 [Personal shooting] [No] Cum swallowing and vaginal cum shot twice! Although it looks neat and clean, it’s a bitch who loves SEX! !! Erotic pie bread that loves vaginal cum shot in raw SEX! High-quality version ZIP, blowjob and ma

  • amateur uncensoredfc2
    • 2020-12-04
    30 min

    FC2PPV 1594123 * Uncensored * Active cabaret girl Kanon-chan Part2 ♡ Continuous vaginal cum shot festival with seniors who called secretly! ★ Luxury review benefits available ★

  • amateur uncensoredfc2
    • 2020-12-05
    159 min

    [SSNI-933]All Alone For A Whole Night With Marin Hinata - Fan Thanks Variety Show - X Loads In All All 8 Times One Night, Two Day Fuckathon With The Porn Star Of My Dreams - Fan Thanks Special

  • marin hinata censoredsingle workSSNIs1 no 1 styletake dSSNI-933SSNI933ssni00933
    • 2020-12-10
    52 min

    H0930 ki201210 Miki Minamino 36years old

  • amateur uncensoredh0930
    • 2020-12-17
    162 min

    [DVDMS-612]A Normal Boys And Girls Focus Group Adult Video These Stepbrothers And Sisters Are Keeping It In The Family And We Followed Up To See What Was Going On In This Special A Kind And Gentle Big Tits Stepsister And Her Cherry Boy Little Stepbro

  • censoredcreampiebig titsDVDMSdeep sgreenhouse effectDVDMS-612DVDMS612dvdms00612
    • 2020-12-18
    39 min

    [BTH-100]Make Me Cum By Throatfucking Me - Maina Yuna

  • yuuri censoredbeautiful girlBTHchobitchchovicBTH-100BTH100h-1435bth00100
    • 2020-12-18
    158 min

    [ABW-037]Aesthetics of a Facial 11 Saved Up Spunk Dumped On A Beautiful Girl's Face For A Man Juice Facial!! Suzu Matsuoka

  • matsuoka tin censoreddeepthroatsingle workABWprestigeshimikkiabsolutely wonderfulABW-037ABW037118abw00037
    • 2020-12-20
    83 min

    FC2PPV 1614035 040 [Large amount of facial cumshots begging for erotic girls in the neighborhood] When I call out to JD passing by, it’s unexpectedly OK OK as it is Cleaning blowjob from mass facial cumshots from raw fit at the hotel

  • amateur uncensoredfc2
    • 2020-12-22
    111 min

    [MSC-002](A Private Video Session) A Threesome Consecutive Raw Creampie Fuck Fest! Miyu-chan (19 Years Old) Looks Just Like ****** Ayase And She's Making Her Boyfriend Wait While She Has Sweaty Cuckold Threesome Sex She's Getting Her Black Pa

  • amateur censoredcreampieamateurMSCfutureMSC-002MSC002
    • 2020-12-26
    119 min

    [MIAA-369]A Married Woman With A Big Ass Is Walking Through The Apartment Building In The Afternoon, Showing Off Her Thong Panties, Transparently Visible Underneath Her Pants, And Luring Men To Temptation Yu Shinoda

  • shinoda yu censoredslutsingle workMIAAmoodyzryo inugamieveryone s porn starMIAA-369MIAA369miaa00369
    • 2021-01-09
    154 min

    [JUFE-246]Dual Sexy Voices: Sweet Angel & Domme Slut's Ultimate Teasing Akari Niimura

  • akari shinmura censoredbig titsslutJUFEfitchaida yumenoJUFE-246JUFE246jufe00246
    • 2021-01-12
    74 min

    [BTHA-060]Hair Nude: Uncensored Cute Faith , Slim Beautiful Girl Hikaru Konno

  • hikaru konno censoredbeautiful girlsingle workBTHAsupa kubijonBTHA-060BTHA0605433btha00060
    • 2021-01-15
    119 min

    [MKMP-373]完全主観 極上おもてなし風俗4変化 星なこ

  • nako hoshi censoredblowjobbeautiful girlMKMPk m producetiger kosakaimillionMKMP-373MKMP37384mkmp00373
    • 2021-01-22
    26 min

    [BTH-109]What If Your Stepmom... Reiko Makihara

  • reiko makihara censoredblowjobmature womanBTHchobitchchovicBTH-109BTH109h-1435bth00109
    • 2021-01-23
    119 min

    [NNPJ-428]"You Seduced Me Because You Want To Fuck Me, Right？ Well Okay Then!" Her Boyfriend Committed Infidelity, And Now, She Just Wants To Get Fucked By Somebody... She's Frustrated And Making Her Adult Video Debut Her Tanlines Are Sup

  • censoredcreampieblowjobNNPJnanpa japanNNPJ-428NNPJ428nnpj00428
    • 2021-01-29
    272 min

    [SKMJ-145]Amateur College Girl Tries A Soapland Brothel In Her Own Home! Experience Everything From A Quick Blowjob To Raw Fucks! She Strokes Her Own Lotion-Slathered Pussy, Then Gives In To The Pleasure Of A Full, Raw Creampie Fuck! "It Feels So

  • censoredbig titssquirtingSKMJred face girlxyzSKMJ-145SKMJ145h-1324skmj00145
    • 2021-01-30
    120 min

    [JJDA-014]The Bride Rubs Her Father-in-law's Shoulders, And Her Father-in-law Rubs Her Breasts. Honota Tsujii

  • tsujii honoka censoredcreampiebig titsJJDAmature woman college real mature womanhirokoji osakimanji groupJJDA-014JJDA014jjda00014
    • 2021-01-30
    186 min

    [WAAA-027]If You Can Endure Rika Aimi`s Awesome Techniques You Can Have Creampie SEX With Her!

  • rumi tadami censoredcreampiebig titsWAAAwanz factorywanzWAAA-027WAAA027waaa00027
    • 2021-01-31
    127 min

    [XVSR-573]A Star Is Born: Exclusive Porn Debut Ichika Mogami

  • ichika mogami censoredbig titssingle workXVSRmax ak c takedacalenXVSR-573XVSR573xvsr00573
    • 2021-02-01
    205 min

    [DKSB-104]They Came For The Cash - Amateur Girls Get Their All-Natural Tits Felt Up - 52 Girls Selected!

  • censoredamateurDKSBoffice k sk s bestDKSB-104DKSB10436dksb00104
    • 2021-02-12
    164 min

    [BOKD-212]A Man's Daughter Is A Gal Bitch: I Might Look Like This, But I Have A Penis. Izumi

  • izumi censoredcreampiebig titsBOKDwe re she malesdorikawaBOKD-212BOKD212h-995bokd00212
    • 2021-02-13
    117 min

    [VEC-465]The Married Woman Next Door Seduces Male Virgins With Her Teeny Tiny Panties & Front-Clasp Bra Mio Kimijima

  • kimishima mio censoredcreampiebig titsVECvenussarumegami venusVEC-465VEC465vec00465
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-22
    62 min

    FC2PPV 1697142 Experienced nurse with 3 boyfriends First shot in life with interest-oriented boyfriend H face. Style. Personality. Reaction. Hugging comfort. Erotic All is just right Nurse-chan And another handjob of rotation is included inside A mas

  • amateur uncensoredfc2
    • 2021-02-25
    120 min

    [RCTD-385]

  • kayo iwasawa ichijo mio censoredschoolgirlRCTDrocketcentral yamamotoRCTD-385RCTD3851rctd00385
    • 2021-03-05
    210 min

    [ABW-063]A Beautiful Girl, A Private Hot Spring, and Steamy Sex 12 I Rented A Beautiful Girl Out For The Night And Took Her To A Hot Spring In The Mountains Umi Yatsugake

  • yakake umi censoredsquirtingsingle workABWprestigeabsolutelyABW-063ABW063118abw00063
    • 2021-03-11
    164 min

    [SVDVD-845]One-Way Mirror Cab Hard Boiled - S********ls We Found In The Street Squirting When They're Tied Up For Multiple Orgasms! These Amateur Girls Can't Stop Cumming For The First Time In Their Lives As They Can't Refuse Creampie Aft

  • censoredcreampiesquirtingSVDVDsadistic villagesushi yokubomagic mirror number sadistic villageSVDVD-845SVDVD8451svdvd00845
    • 2021-03-27
    136 min

    [KNMB-011]Totally Raw STYLE @ Rimi #Half-In, Half-Out #G-Cup Colossal Tits #True Nature #Her First Slutty Video #Busty S********l #Cum-Swilling Pussy #Sugar Babe #Creampie Rimi Momono

  • rimi momono censoredcreampiebig titsKNMBfirst star100 raw styleKNMB-011KNMB011h-491knmb00011
    • 2021-04-14
    224 min

    [HUNTA-991]There's Only One Guy Working At My Lingerie Company - Me! Every Day I'm Surrounded By Girls With Fine Tits And Godly Asses! You Won't Believe What Else I Feast My Eyes On At The Office, Either...

  • censoredcreampielingerieHUNTAhuntercognac kaminohhh groupHUNTA-991HUNTA991hunta00991
    • 2021-05-21
    66 min

    [FTHT-014]"A Celebration Of Heavenly Ecstasy! Endless Orgasms! The Scream Coaster Of Your Dreams!" Roaring Highs And Bottomless Lows Of Bliss! Orgasms That Are Out Of This World Intense! The Closest You'll Ever Get To Heaven In This World

  • censoredcreampiesquirtingFTHTfalenodavielfalenotubeFTHT-014FTHT0141ftht00014
    • 2021-05-28
    60 min

    Caribbeancom 052821-001 Complaint Office Lady Apologize with the Body Vol.7 Sakura Kojima

  • sakura kojima uncensoredcreampiecaribbeancom
    • 2021-06-04
    82 min

    [YMDS-032]Young Lady's Catering Service! Angelic Little Ena (K-Cup)'s Devilish Bouncy Big Tits! Ena Koume

  • ena koume censoredcreampiebeautiful girlYMDSmomotaro video publishingasakusa is jiroyoung peachYMDS-032YMDS032ymds00032
    • 2021-06-20
    240 min

    [OKAX-750]Cock-Teasing Angel In A White Coat! The Job of An Erotic Nurse

  • nanki sea yuri fujimoto censoredslutnurseOKAXk m produceokazuOKAX-750OKAX750okax00750
    • 2021-07-02
    144 min

    [JUL-631]A Married Woman Secretary, Engaged In Creampie Sex, Filled With Sweat And Kisses, In The Boss' Office The Ultimate In Bewitching Beauties Will Provide You With The Ultimate In Kissing (Creampie Sex) In This Masterpiece Drama!! Ryo Ayumi

  • ayumi ryo censoredcreampiemature womanJULmadonnanagaeJUL-631JUL631jul00631
    • 2021-07-09
    121 min

    [DASD-889]My husband and I have a real sexless marriage. I have been holding back my sexual urges and want to cum. A national treasure of a neglected slut with super soft H cup tits who makes the dicks of other men than her husband ejaculate hard in

  • censoredcreampiebig titsDASDdasDASD-889DASD889dasd00889
    • 2021-07-11
    47 min

    FC2PPV 1917351 Up to 18 2000 [No] Fair-skinned busty beauty college student. Although she reluctantly resists, she is forcibly fucked by multiple men and vaginal cum shot is made continuously on her dangerous day.

  • amateur uncensoredfc2
    • 2021-07-17
    120 min

    [DASD-892]Newlywed Flirtation With A Beautiful Trans Bride, Starring Sara Aizawa

  • aizawa sara censoredanalbeautiful girlDASDdashiromichi hoseDASD-892DASD892dasd00892
    • 2021-07-17
    119 min

    [JUL-657]The Conversion of a Married Woman. Momoko Isshiki.

  • momoko isshiki censoredmature womansingle workJULmadonnajyoji kawaiJUL-657JUL657jul00657
    • 2021-07-22
    126 min

    [JRZE-063]First Time Filming My Affair. Arisa Funaki.

  • arisa funaki censoredcreampiemature womanJRZEcenter villageminatoyajurakuJRZE-063JRZE063h-086jrze00063
    • 2021-08-07
    228 min

    [XRLE-013]Creampies Deep Down The Throat Of A Beautiful Girl: Breaking Her In For Deep Throats. Rena Aoi.

  • blue censoredbeautiful girldeepthroatXRLEk m produceani nakamurareal real worksXRLE-013XRLE013xrle00013
    • 2021-08-18
    47 min

    FC2PPV 2041944 Beautiful Breasts Dental Assistant With A Model Face Showing Off A Superb Blow Job With A Sticky Tongue And Plump Lips 24 Years Old → Cum

  • amateur uncensoredfc2
    • 2021-09-03
    122 min

    [JUFE-326]Shared Room At The Inn On A Business Trip! Her Most Hated Boss Makes Her Cum Over And Over... Kokona Asakura

  • asakura here censoredcreampiebig titsJUFEfitchJUFE-326JUFE326jufe00326
    • 2021-09-10
    238 min

    [IDBD-850]She Tried To Resist, But Succumbed To The Pleasure, And With Each Fuck, She Found Herself Desiring More And More Stimulation ... A Melancholy Erection! A Collection Of Exclusive Idea Pocket Actresses In Cuckolding Situations

  • nanami misaki akari tsumugi censoredbig titsdramaIDBDidea pocketaideapoketto bestIDBD-850IDBD850idbd00850
    • 2021-09-18
    20 min

    FC2PPV 2214756 [Preparation For Freezing] Lost Virginity Due To Gonzo With A Certain Tokyo Cram School Student. Too Raw …..

  • amateur uncensoredfc2
    • 2021-10-06
    125 min

    [GVH-298]Sexual Harassment Secretary: She Loathes Him, But Her Dirty, Old-Fuck Boss Won"t Keep His Sticky Hands Off Her Gorgeous Hard Body Toka Rinne

  • roaring sound censoredbig titsgrandfatherGVHglory questham the mcGVH-298GVH298gvh00298



    • Jav Cherry, watch JAV streaming online japanese xxx