slut big tits jav censored mature woman




FC2AMBIAUKGABWEBODGVHMIAAWAAAADNWANZMIDESQTECAWDDASDSSISCHRVPREDCESDBLKHODVMVSD

2021-01-01
483 min

[DCX-120]DOC Best Selection 2020 The Daydream Fantasies Of Men, Collected Here! Beware Of Too Much Nookie! 8 Hours

  • censoredcreampieschoolgirlDCXprestigedoc maxDCX-120DCX120118dcx00120
    • 2021-01-08
    86 min

    380SQB-083 Koharu

  • amateur censoredamateurblowjobsqbsqb-083sqb083sqb-083
    • 2021-01-09
    141 min

    [JUFE-247]Fine-Booty MILF Seduced By Her Step-Nephew's Healthy Young Cock Nanami Nagata

  • minami nagata censoredcreampiesingle workJUFEfitchJUFE-247JUFE247jufe00247
    • 2021-01-09
    119 min

    [EBOD-794]Swapping Stepsisters - "I'll Let You Grope My Stepsister's Big Tits If You Do The Same For Me!" - 2 Girls And 2 Guys Fuck Like Monkeys In The Summer Countryside - Yukino Nagisa, Ruka Inaba

  • yukino nagi inaba censoredcreampiebig titsEBODe bodyxavier thomas 2EBOD-794EBOD794ebod00794
    • 2021-01-15
    142 min

    [GZAP-038]An Amateur NTR Posting!!! I'm Posting All The Most Outrageous Videos Of Sex Videos Featuring Me And My Friend's Girlfriend LOL

  • censoredamateurGZAPprestigezapGZAP-038GZAP038118gzap00038
    • 2021-01-16
    50 min

    C0930 hitozuma1345 Sonomi Hijiri 27years old

  • amateur uncensoredc0930
    • 2021-01-23
    66 min

    Pacopacomama 012321_425 Ai Aoyama

  • ai aoyama uncensoredcreampieblowjobpacopacomama
    • 2021-02-07
    107 min

    [VENX-005]Stepmom Desperate For Her Stepson's Creampie Sucks His Cock To Get Him Hard And Makes Him Fuck Her Until His Balls Are Drained Dry - Endless At-Home Sex Ruka Inaba

  • inaba censoredcreampiebig titsVENXvenusmajime kitanofakecest winntersVENX-005VENX005venx00005
    • 2021-02-08
    66 min

    SIRO-4412 [First shot] [Miniskirt panchira] [Naughty F milk] F milk girl’s naughty pussy overflows lewd honey every time she pokes a big cock .. AV application on the net → AV experience shooting 1461

  • amateur censoredbig titsamateursirosiro-4412siro4412siro-4412
    • 2021-02-18
    120 min

    [TPPN-184]Incredible Orgasms - Abs Tensing With Climactic Pleasure - Sex X Oral X Fingering - 11 Loads Awakens Her Female Instinct Mahiro Ichiki

  • mahiro ichiki censoredblowjobsingle workTPPNteppanTPPN-184TPPN184tppn00184
    • 2021-02-19
    152 min

    [MMYM-043]Obscene Woman June Lovejoy

  • june lovejoy censoredslutsingle workMMYMmarrionaida yumenoyumenoMMYM-043MMYM043mmym00043
    • 2021-02-19
    87 min

    [SS-016]Clarity Hikari Azusa

  • censoredcreampieschoolgirlSSglory questSS-016SS016h-113ss00016
    • 2021-02-21
    32 min

    FC2PPV 1696338 [No] A young wife with tall and beautiful legs. She sells her body to the end of a gambling addiction.

  • amateur uncensoredfc2
    • 2021-03-02
    129 min

    [MSFH-052]Coworker Temptation: Working Overtime With The Hottest Girl In The Office And She Seduces You And Drains Your Balls Dry Konomi Yoshinaga

  • konomi yoshinaga censoredsingle workMSFHsodms sodMSFH-052MSFH0521msfh00052
    • 2021-03-06
    240 min

    [DVDMS-640]A Normal Boys And Girls Focus Group Adult Video A Thorough Investigation Of The Lust Of An Amateur College S*****t If They Can Resist Having Sex Until The Break Of A Dawn, They'll Win 100,000 Yen! After Missing Their Last Train Home, T

  • censoredcreampieamateurDVDMSdeepsdeep sDVDMS-640DVDMS640dvdms00640
    • 2021-03-09
    482 min

    [MUCH-123]Colossal Tits! Big And Bouncy Maniacs 2 Sex With 10 Sluts 8 Hours 2 Video Set

  • megumi arina akatsuki minami censoredcreampiebig titsMUCHmothermuchi mutchiMUCH-123MUCH123h-796much00123
    • 2021-03-13
    171 min

    [JUFE-269]This Voluptuous Slut Will Look Down Upon You With Absolute Contempt As She Exercises Dirty Talk Control Over you The Ultimate POV JOI Video As She Controls Your Ejaculations Chitose Yuki

  • chitose in the evening censoredbig titssingle workJUFEfitchaida yumenoJUFE-269JUFE269jufe00269
    • 2021-03-18
    60 min

    336KNB-146 A Young President Lady Who Came To Dissipate Stress Because She Couldn’t Endure Her Husband’s Bondage! After a long time, he goes crazy with other sticks, exposes his plump body in front of the camera, and is attacked by ripe hon

  • amateur censoredcreampiemarried womanknbknb-146knb146336knb-146
    • 2021-03-19
    53 min

    FC2PPV 1732238 36-year-old slender beautiful married woman and Gonzo! !! I’m excited and my body is fluttering! I have made a vaginal cum shot for the first time! !! [High image quality]

  • amateur uncensoredfc2
    • 2021-03-24
    49 min

    444KING-032 Honoka (20)

  • amateur censoredcreampiebig titskingking-032king032444king-032
    • 2021-04-17
    181 min

    [AKID-083]@I Started My Sex Life!! #Takehome vol. 2

  • censoredAKIDomochikaeri mousozokumanji groupAKID-083AKID083akid00083
    • 2021-04-18
    143 min

    [KATU-081]Beautiful Woman x Big Tits x Big Ass Picking Up Super Slutty Wives Girls With Their Asses Bursting Out Of Their Mini Skirs Are Total Nymphos!

  • censoredslutKATUkatsuo bussan mousouzokumaglowKATU-081KATU081katu00081
    • 2021-04-30
    244 min

    [HEZ-278]How To Make An Old Lady Business Trip Massage Therapist Cum I Understand! You Haven't Been Getting Any Lately, Right？ Let Me Use My Rock Hard Cock As A Weapon To Bring You Orgasmic Ecstasy! 14 Ladies

  • censoredbig titsmature womanHEZhot entertainmenthot premium archiveHEZ-278HEZ27859hez00278
    • 2021-05-21
    120 min

    [JUL-583]Wow, I Got To Share A Room With The Female Boss I Admire So Much On Our Business Trip Together - Nozomi Tanihara

  • nozomi tanihara censoredmature womansingle workJULmadonnaunicorn fukudaJUL-583JUL583jul00583
    • 2021-05-29
    124 min

    [XVSR-593]Steamy Sex MAX-A Exclusive Actresses Ichika Mogami's First Time Having Real Adult Sex

  • ichibana mogami hana sato censoredbig titssquirtingXVSRmax ak c takedacalenXVSR-593XVSR593xvsr00593
    • 2021-06-01
    53 min

    FC2PPV 1847794 TKBZ ＃ 012 ☆ Worked at a famous bookstore in Tokyo ☆ Shortcut black hair beauty (26) Hairless woman on top posture without rubber while showing off this vaginal cum shot as it is

  • amateur uncensoredfc2
    • 2021-06-08
    61 min

    200GANA-2498 In The Spear Room Of The Nampa Master Of Hyakusen Hakusen, Bring In SEX Hidden Shooting 207 Bring An Estimated H Cup Big Breasts Girl At Home! Oma ● Ko’s sensitivity is too high and cums next to cum in every position! Record perfect

  • amateur censoredbig titsamateurganagana-2498gana2498200gana-2498
    • 2021-06-10
    119 min

    [HBAD-585]A Mother Was Made To Have Sex With Her Son's Friends To Relieve Their Sexual Desire And Ended Up Being Covered In Semen Ayano Fuji

  • ayano kato censoredmomsingle workHBADhibinodragon nishikawababeHBAD-585HBAD5851hbad00585
    • 2021-06-11
    153 min

    [JUFE-296]Competitive Eater With An Insatiable Appetite For Food... And Cock! Pretty Grown Up Slut With A Sweet Smile - This Former Beach Volleyball Player Voraciously Devours Anything Put In Front Of Her In Her Porn Debut!

  • censoredbig titsJUFEfitchJUFE-296JUFE296jufe00296
    • 2021-06-23
    27 min

    FC2PPV 1884727 * Until the 30th [Individual shooting] Prefectural General Course ② Assistance to fill the loneliness of a little girl. Squirting with a raw penis

  • amateur uncensoredfc2
    • 2021-07-14
    50 min

    494SIKA-099 "I Want You" J ○ Who Turned Onaho With An Aphrodisiac Spree

  • amateur censoredschoolgirlamateursikasika-099sika099494sika-099
    • 2021-07-23
    121 min

    [VEC-487]I Seduced The Virgin Next Door With A Bra And Tiny Panties Akari Neo

  • akari neo censoredcreampiemature womanVECvenuskaniemegami venusVEC-487VEC487vec00487
    • 2021-08-13
    45 min

    480FRIN-045 "Personal Shooting" P Adult Scene Voyeur Of A Beautiful Female College Student. Sweaty Middle-Aged Ji ● Nasty Big Butt Who Devours Po Continuously Cum Straddling Raw Sex

  • amateur censoredcreampieamateurfrinfrin-045frin045480frin-045
    • 2021-08-20
    60 min

    SIRO-4573 [First Shot] [Lustful Kissing Face] [Erection Inevitable Melting Face Blowjob] A Flower Coordinator Who Can’T Stand The Gap That Changes From A Smile To A Fluffy Face. She Holds A Cock Deep In Her Mouth With Her Upper And Lower Mouths

  • amateur censoredamateursirosiro-4573siro4573siro-4573
    • 2021-08-24
    115 min

    460SPCY-021 [20 Years Old Kanagawa Prefecture] Yui

  • amateur censoredcreampiebig titsspcyspcy-021spcy021460spcy-021
    • 2021-09-11
    120 min

    [NASH-569]Deep And Rich Eros Company Erotica, Powered By Attachment And Foreplay The Moment When A Woman Who Has Continuously Provided Pleasure Succumbs To Lesbian Lust

  • censoredlesbianNASHpinknadeshikoNASH-569NASH569nash00569
    • 2021-09-11
    240 min

    [NASH-567]"Forgive Me For This" Crazed And Lustful After Being Made To Cheat

  • aoi mizutani hitomi honjo censoredbig titsmarried womanNASHpinknadeshikoNASH-567NASH567nash00567
    • 2021-09-18
    134 min

    [SORA-334]"Someone Is Looking At Me With Lewd Eyes..." A Beautiful Office Lady Who Relieves Stress By Exposing Herself Outdoors And Fucked A Masochist Peeping Tom Passing By. Aya Shiomi

  • aya shiomi censoredsingle workSORAyama to sorausubashi suiSORA-334SORA334sora00334
    • 2021-09-18
    148 min

    [FLAV-280]Slutty Bunny Girl Is A Carnivorous Masochistic Bitch Alice Otsu

  • otsu alice censoredbig titssquirtingFLAVdigital arkdigital ark dejitarua kuFLAV-280FLAV280flav00280
    • 2021-10-01
    119 min

    [NNPJ-476]Real On-The-Street Interview In Kabukicho. We Found Broke, Runaway Girl Koharu In the To-Yoko Neighborhood, Then Took Her Back To Our Place To Use As A Fucktoy

  • censoredcreampieblowjobNNPJnampa japanNNPJ-476NNPJ476nnpj00476
    • 2021-10-09
    125 min

    [BADA-022]Welcome, You Married Woman! Married Women Covered with Sluttiness vol. 1

  • censoredcreampieamateurBADAbarutanyuuseidiamondBADA-022BADA022bada00022
    • 2021-10-14
    121 min

    [MEKO-216]"The Old Lady Rental" Service Returns 05 If You Ask This Sexy And Kind Old Lady, She"ll Secretly Let You Have Creampie Sex, And I Seriously Wanted To Fuck Her Again Like Crazy, So I Asked For Second Helpings

  • censoredcreampieamateurMEKOjukujo laboMEKO-216MEKO216h-1160meko00216
    • 2021-10-19
    541 min

    [OOMNVD-003]Young Wife"s Carnivorous Intercourse - An Afternoon Affair BEST

  • mao watanabe miyazaki ri censoredbig titsmarried womanOOMNVDabc delusion groupmom.com abc delusion groupOOMNVD-003OOMNVD003oomnvd00003
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-10
    24 min

    FC2PPV 2417368 Until Today! "# 13" An Innocent Country Girl. I Forcibly Inserted It In The Middle … The Sense Of Immorality Was Too Bad. ♡ Dialect Moe ♡

  • amateur uncensoredfc2
    • 2021-11-15
    69 min

    374IMGN-031 Riana (20)

  • amateur censoredsquirtingamateurimgnimgn-031imgn031374imgn-031
    • 2021-12-17
    168 min

    [MIAA-544]Ten Years Of Protecting My Chastity From My Father-in-law Who I Hate... I"ve Only Gotten Better At Sucking Cock... Luna Tsukino

  • tsukino luna censoredschoolgirlblowjobMIAAmoodyznao masakieveryone s porn starMIAA-544MIAA544miaa00544
    • 2021-12-23
    192 min

    [NHDTB-614]Breast Milk M****ter

  • censoredbig titsmarried womanNHDTBnatural highraftin maeshiroNHDTB-614NHDTB6141nhdtb00614
    • 2021-12-24
    120 min

    [JUL-807]『逸材』超・大型専属×本格『凌●』寝取られシリーズ！！ 夫の上司に犯●れ続けて7日目、私は理性を失った…。 安みなみ

  • minami ahn censoredmature womansingle workJULmadonnatakeshi kogaJUL-807JUL807jul00807
    • 2021-12-27
    51 min

    498DDH-056 [Raw Saddle From A Girl Who Picked Up Girls And A Karaoke Drink! Don’t Wake Up Your Drunken Friends …] The Girl Who Looked Like A Flower Of Takamine Is A Little Touching! Even Though My Friend Is Sleeping Right There, I Shake My

  • amateur censoredcreampieamateurddhddh-056ddh056498ddh-056
    • 2022-01-14
    151 min

    [PPPD-993]This Is The First Time I"ve Ever Been To The Beach. It"s Always A Usachan With Big Tits Serving You Closely! Yubi Ong

  • evening beauty censoredcreampiebig titsPPPDoppaiPPPD-993PPPD993pppd00993
    • 2022-01-21
    100 min

    [VEC-516]A Secret Between My Friend"s Mother And Me. The Fact That I Made My Aunt Have Sex With Me Inside... Mayu Suzuki

  • suzuki mayu censoredcreampiebig titsVECvenuspetermegami venusVEC-516VEC516vec00516
    • 2022-01-22
    124 min

    [GENM-100]The Fate Of The Captured Maid - A Perverted Pastime With Her Rough Master - Mari Takasugi.

  • mari takasugi censoredblowjobsingle workGENMgenekig 3GENM-100GENM100genm00100
    • 2022-01-31
    63 min

    SIRO-4765 [First Shot] [Obvious Plump Body] [Shaking Obscene G Milk] Gap From The Interview ○, A College Student With A Plump Body Appeared. While Saying That It Is For Money, If A Cock Is Inserted, It Will Reach The Climax Many Times With A Reaction

  • amateur censoredbig titsamateursirosiro-4765siro4765siro-4765
    • 2022-02-01
    48 min

    10musume 020122_01 The School Uniform: Hot And Cold Who Always Listens To Anything I Say Yu Nagata

  • amateur uncensored10musume
    • 2022-02-06
    122 min

    500DPL-0062 Human Livestock Ranch-That Strongest And Worst Series Is Back! ~ Sakura Tsuji / Hikaru Minazuki / Kurumi Ryohana

  • amateur censoredamateurbeautiful girldpldpl-0062dpl0062500dpl-0062



    • Jav Cherry, watch JAV streaming online japanese xxx