shiro




FC2NACXEBODWAAAJUFEDASDSHKDHUNTBSDABNACRAVSAFSDSSSSNIPREDMEYDVEMAPPPDKSBJDTTIPXAPOD

2020-11-12
224 min

[FTBLD-001]#Looking For A Friend To Fuck (An Investigation) Is It Possible To Take Home A Girl That You Just Met With A Hookup App？ Episode 1 Feat. FALENOTUBE

  • censoredbig titssquirtingFTBLDfalenodavielfalenotubeFTBLD-001FTBLD0011ftbld00001
    • 2020-11-17
    55 min

    10musume 111720_01 Natural young wife: A gambling lover’s married woman pays off a large amount of debt in a split payment Mei Katayama

  • amateur uncensored10musume
    • 2020-11-19
    135 min

    [SORA-282]I Want To Show Off: An Exhibitionist Diary - Mizuki Sanada

  • mizuki sanada censoredbig titsslutSORAyama to sorahimu lockSORA-282SORA282sora00282
    • 2020-11-27
    102 min

    [YST-233]Miserable Step--parents - Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiedeepthroatYSTkomyoYST-233YST233540yst00233
    • 2020-11-27
    99 min

    [SHMO-177]"I'm Cumming With My Girlfriend! A Lovey-Dovey Coed Bathing Hot Spring Resort Date!"

  • amateur censoredSHMOorustak softSHMO-177SHMO177
    • 2020-11-29
    261 min

    [GAV-056]A Private Sexy Girl Pay-For-Play Video Session

  • censoredcreampieamateurGAVgogo adult videosGAV-056GAV056gav00056
    • 2020-12-05
    118 min

    [JUL-390]Ex-Swimsuit Model Married Woman: Exclusive MILFs Volume 3!! A Night Alone Together With My Hot Sister-In-Law During A Blackout... Mizuho Aoyama

  • mizuho aoyama censoredbig titsmature womanJULmadonnashiro shotenJUL-390JUL390jul00390
    • 2020-12-26
    149 min

    [CLUB-626]Sweaty Former Delinquent Married Woman Goes On Indecent D***king & Fucking Trip With Younger Coworker (CLUB-626)

  • censoredcreampiebig titsCLUBhentai shinshi clubCLUB-626CLUB626club00626
    • 2020-12-31
    120 min

    [PRED-282]Barely Legal Teen's Chance Encounter With An Older Guy - Boomer Breeds Millennial To Raise The Birth Rate... Ai Hoshina

  • sena ai censoredcreampieuniformPREDpremiumkitorune kawaguchielegancePRED-282PRED282pred00282
    • 2021-01-01
    213 min

    [FP-036]Hidden Camera Voyeur Footage At A Massage Clinic 4 - Her Lips Look Just Like Labia / She'll Loosen Up With A Little Liquor / She'll Let Me Stroke Her Light Skin And Soft Breasts If I Ask Nicely / She Makes Such Sweet Moans

  • censoredcreampieFPplumshirouto only plumFP-036FP036h-113fp00036
    • 2021-01-10
    107 min

    [VENU-997]MILF Stepmom Seduces Her Stepson With Quiet Whispers So Her Husband Won't Know Maria Nagai

  • maria nagai censoredcreampiebig titsVENUvenussarufakecest winntersVENU-997VENU997venu00997
    • 2021-01-17
    108 min

    [MGMP-055]Handjob From A Slut Dental Hygienist Wearing Rubber Gloves - The Ultimate Sub Cleaning! 3

  • natsuki kisaragi yuka hirose censoredsluthandjobMGMPmegamibeautiful goddess premiumMGMP-055MGMP055mgmp00055
    • 2021-01-29
    49 min

    FC2PPV 1663333 [No] 1/31 Deleted Video scale 90 minutes Limited 50 pieces Please understand the reason why many can not be distributed [Personal shooting]

  • amateur uncensoredfc2
    • 2021-01-30
    148 min

    [MIMK-083]Cuckolding A Wife Next Door With Aphrodisiacs: The First Collaboration Between Popular Manga Artist Ishito Yura And MOODYZ! Haru Kawamura

  • kawamura haru censoredcreampiebig titsMIMKmoodyzkitorune kawaguchimankitsuMIMK-083MIMK083mimk00083
    • 2021-01-30
    186 min

    [WAAA-027]If You Can Endure Rika Aimi`s Awesome Techniques You Can Have Creampie SEX With Her!

  • rumi tadami censoredcreampiebig titsWAAAwanz factorywanzWAAA-027WAAA027waaa00027
    • 2021-02-01
    34 min

    [PYU-130]This Woman Was Meant To Bless Us As A Teacher, And Now We're Training Her Voluptuous Body To Obey Our Cocks And Re-Initiate Her Into A Most Divine Occupation! Kaede Niyama

  • kaede niiyama censoredbig titsPYUcome camPYU-130PYU130h-1462pyu00130
    • 2021-02-08
    35 min

    FC2PPV 1678073 [No] ♯ Nice ass healing girlfriend. Two Gonzo Memorial Sex.

  • amateur uncensoredfc2
    • 2021-02-11
    122 min

    [HBAD-574]Plain-Looking Office Lady With Big Tits Gets Caught Having An Affair At Work Receives Bukkake - Naoko Akase

  • naoko akase censoredbig titssingle workHBADhibinorokutanzo no seishibabeHBAD-574HBAD5741hbad00574
    • 2021-02-22
    143 min

    [AGMX-071]Titty Lust Delights - Thank You For Such Big Titties, And Congratulations For Having Titties Bigger Than G-Cups -

  • natsuho imai nene tanaka censoredbig titsAGMXsex agent daydreamersdaibutsu yoshidasex agentAGMX-071AGMX071agmx00071
    • 2021-02-27
    56 min

    383REIW-035 Orchid

  • amateur censoredbig titsamateurreiwreiw-035reiw035383reiw-035
    • 2021-03-05
    54 min

    499NDH-005 Over 3 digits of experience! With a neat face, a spear man’s fair-skinned beauty body girl is stabbed! Two vaginal cum shots in a professional beauty maco who eats and catches a man! !! [Is it okay to have the mask removed？ 1st person

  • amateur censoredcreampieamateurndhndh-005ndh005499ndh-005
    • 2021-03-16
    93 min

    261ARA-482 [Super Miracle Beautiful Girl] 20 Years Old [Boyish with Shortcut] Suzu-chan Visits! The reason for her application to work part-time at a ramen shop is "I lost my curiosity ♪" AV appearance without telling my boyfriend! The desire

  • amateur censoredamateuraraara-482ara482261ara-482
    • 2021-03-29
    68 min

    FC2PPV 1720415 I was introduced to her (female lawyer) by an elite office worker who desires NTR, so I fell asleep in front of my boyfriend ❤️ There is a purchase privilege

  • amateur uncensoredfc2
    • 2021-04-05
    376 min

    [DANUHD-002]The Mysterious Princess With A Shaved Pussy: Nadia 18 Years Old AV Debut + 1 Work

  • nadia censoredbeautiful girlsingle workDANUHDdandydandyuhdDANUHD-002DANUHD0021danuhd00002
    • 2021-04-14
    114 min

    [ARM-972]Close Up French Kissing X Slow Thigh Job

  • rion izumi kagami sara censoredARMaroma planningshigeo kadowakiaromaARM-972ARM972arm00972
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-06
    130 min

    [JRZE-047]First Time Filming My Affair: Rika Yamaguchi

  • rika yamaguchi censoredcreampiemature womanJRZEcenter villageminatoyashoku ureJRZE-047JRZE047h-086jrze00047
    • 2021-05-07
    66 min

    230OREC-758 Hakucho

  • amateur censoredcreampiebig titsorecorec-758orec758230orec-758
    • 2021-05-07
    60 min

    230OREC-760 Nakagawa

  • amateur censoredcreampiebig titsorecorec-760orec760230orec-760
    • 2021-05-14
    244 min

    [SKMJ-166]Happy Endings Are Against The Rules At This Men's Massage Parlor, But After 3 Months This Gorgeous Slut Is Willing To Make Exceptions For Loyal Customers - Her Secret Raw Creampie Sex Options Filmed On Hidden Cameras

  • censoredcreampieamateurSKMJred face girlSKMJ-166SKMJ166h-1324skmj00166
    • 2021-05-15
    141 min

    [SORA-312]She Transforms Into A Slut After School! S********l With H-Cup Tits Loves To Expose Herself Ena Koume

  • ena koume censoredbig titsschoolgirlSORAyama to sorausubashisuiSORA-312SORA312sora00312
    • 2021-05-15
    64 min

    FC2PPV 1818543 [Individual shooting] ＃ 61 Off-paco after school A sweet-hearted beautiful girl with a strong libido 18 years old Forget about me for the first rubberless SEX and sprinkle erotic juice [Limited]

  • amateur uncensoredfc2
    • 2021-05-21

    FC2PPV 1828654 First shot !! Limited number [Uncensored] Super beautiful woman with tall legs! Creampie to the receptionist of the beauty clinic! !! (Part 1)

  • amateur uncensoredfc2
    • 2021-05-22
    241 min

    [OKAX-740]Step Son Ravishes His Resisting Step Mother! Raw Fucking 4 Hours

  • censoredmature womanmomOKAXk m producedick mandokuokazuOKAX-740OKAX740okax00740
    • 2021-06-05
    137 min

    [TSF-020]What Happens If You Attend An All Boys School When You Wake Up In The Morning To Find That You Were Transformed Into A Girl - A Thorough Investigation I Always Thought That "Sex Was No Big Deal" But Then When I Was Taught What Real S

  • shuya shima censoredcreampiecosplayTSFkaguyahimept mousouzokugynecomastia reportTSF-020TSF020tsf00020
    • 2021-06-20
    118 min

    [DBER-116]Cruel, Bizarre Sex Training - Ninjas - Female Ninja's Ass Broken In - Episode 2 - The Thousand Delights Of Paradise Rion Izumi

  • rion izumi censoredanalbdsmDBERbabyentertainmentkikubonred babeDBER-116DBER116dber00116
    • 2021-06-25
    170 min

    [BDSM-075]Breaking In Record Of Masochist Actress Aya Shiomi

  • aya shiomi censoredsingle workBDSMtaitokaibind maniaBDSM-075BDSM075h-1096bdsm00075
    • 2021-07-31
    107 min

    [VEC-488]A Secret Only Between My Friend"s Mother And Me. That I Fucked And Had Creampie Sex With Her... Reina Hirokawa

  • reina hirokawa censoredcreampiemature womanVECvenuskitano majimemegami venusVEC-488VEC488vec00488
    • 2021-07-31
    54 min

    FC2PPV 1949449 I Took A Gonzo Of A 1-Year-Old J-Cup God-Style Child

  • amateur uncensoredfc2
    • 2021-08-20
    135 min

    [JUL-686]Unending Days of Creampie G*******gs Kana Yume

  • kana yui censoredcreampiemature womanJULmadonnaunicorn fukudaJUL-686JUL686jul00686
    • 2021-08-29
    52 min

    229SCUTE-1124 Marina (24) S-Cute Squirting H Of A Neat Black-Haired Beautiful Girl

  • amateur censoredsquirtingamateurscutescute-1124scute1124229scute-1124
    • 2021-09-02
    64 min

    Pacopacomama 090221_526 The Training For Wife: Beautiful Wife who is My Sex Toy Loves to Be Dominated Hitomi Yoshimura

  • amateur uncensoredpacopacomama
    • 2021-09-09
    127 min

    [MEKO-213]"The Old Lady Rental" Service Returns 02 If You Ask This Sexy And Kind Old Lady, She"ll Secretly Let You Have Creampie Sex, And I Seriously Wanted To Fuck Her Again Like Crazy, So I Asked For Second Helpings

  • censoredcreampieamateurMEKOmature woman laboMEKO-213MEKO213h-1160meko00213
    • 2021-09-17
    240 min

    [DVDMS-716]A Normal Boys And Girls Focus Group Adult Video A College Girl Big Stepsister And Her Little Stepbrother Are Taking The Thrilling 24-Hour Roulette Life Challenge! This Big Stepsister And Her Little Stepbrother Spin The Wheel And Complete E

  • censoredcreampieamateurDVDMSdeepspoolsidedeep sDVDMS-716DVDMS716dvdms00716
    • 2021-09-18
    119 min

    [HALE-007]Mom"s Fuck Buddy Unlimited Loop vol.7 Reina Experienced In Husbands

  • censoredbig titsamateurHALEhalentino mousouzokuhalentinomom friend eating infinite loopHALE-007HALE007hale00007
    • 2021-09-25
    156 min

    [MADV-512]C***dhood Friend That"s Completely Sex Crazed From Breaking In Is Given Over To A Serious Friend. Aoi Kururugi

  • aoi kururugi censoredcreampiebeautiful girlMADVcrystal eizoupearlrice sakagamimaniac crystalMADV-512MADV512madv00512
    • 2021-10-01
    48 min

    491TKWA-196 Creampie With Extreme Slender Daughter And Raw Saddle! (Hitomi Hoshitani)

  • amateur censoredcreampieuniformtkwatkwa-196tkwa196491tkwa-196
    • 2021-10-02
    141 min

    [EVIS-374]Getting Rubbed By A Booted Slut"s Sweaty Feet And Dirty Talk

  • anne mashiro minami saya censoredlesbianEVISebisusan mousou zokucherry miyamaEVIS-374EVIS374evis00374
    • 2021-10-21
    50 min

    413INST-176 [Married Woman / Orgy Individual Shooting] Big Breasts I Cup ★ Spodim Married Woman Who Trains To A Super Body Like A Model. It Falls Alive By Being Stabbed By A Big Cock Near A Mama Friend. Of Course, Plenty Of Seeding! (Rinne)

  • amateur censoredcreampiebig titsinstinst-176inst176413inst-176
    • 2021-10-22
    179 min

    [HMN-056]Newcomer, 18 Years Old, 145 cm Tall. The Light Tanned Sensitive Minimum Body"s Creampie JAV Debut. Mion Hayama

  • hayama mine censoredcreampiebeautiful girlHMNhonnakausapyonHMN-056HMN056hmn00056
    • 2021-10-29
    40 min

    FC2PPV 2385000 [No] Look At This Time! That Popular G-Cup Busty Beauty Last Appearance! Last Gonzo * Review Benefits / High Image Quality Ver.

  • amateur uncensoredfc2
    • 2021-11-08
    89 min

    SMUK-074 Yuzu 2 (Yuzu Shirakawa)

  • amateur censoredcreampieuniformsmuksmuk-074smuk074smuk-074
    • 2021-11-12
    118 min

    [PRED-355]Noble Undercover Agent"s Aphrodisiac Cum Creampie And Sense of Honorable Mission As Struggle Ends...Riho Fujimori

  • riho fujimori censoredcreampiebig titsPREDpremiumkitorune kawaguchielegancePRED-355PRED355pred00355
    • 2021-11-18
    302 min

    [TOEN-055]Hot MILF Porn Debut: Don"t Tell Her Husband, This Is For Real! 6 Mature Girls, 300-Minute Special

  • censoredmarried womanmature womanTOENcenter villagetaoyuanTOEN-055TOEN055h-086toen00055
    • 2021-12-04
    130 min

    [GVH-324]Titty-Loving Shota-kun"s Lewd Prank Hana Himesaki

  • himesaki hana censoredbig titsschoolgirlGVHglory questtakahashi chitsujiGVH-324GVH324gvh00324
    • 2021-12-14
    479 min

    [KTRA-359]10 Beautiful Girls With Big Tits Having Sex In A Row, 8 Hours, 2 Discs, KTRA-. 359

  • takarada monami jun kawaguchi censoredcreampiebig titsKTRAk tribeKTRA-359KTRA359h-094ktra00359



    • Jav Cherry, watch JAV streaming online japanese xxx