shaved beautiful girl censored jav creampie




FC2NGODBLKMIAAPREDABWCJODCESDCHRVPPPDMIDESSISDASDVEMAMILKDASDDTTWAAANACXMEYDSHKD

2021-01-14
88 min

[ACZ-005]Livestock Collector Vol. 03 - Wild Masochist Female CEO Hinata

  • censoredamateurbdsmACZsanwa publishingabnormal.companiesACZ-005ACZ005h-019acz00005
    • 2021-01-22
    130 min

    [KUM-012]Intruder 02

  • censoredcreampiebdsmKUMprestigejanhirokyuryu prestigeKUM-012KUM012118kum00012
    • 2021-02-05
    241 min

    [BUR-565]Posting Of A Itty Bitty Babes! The Size Of Their Raging Lust Doesn't Match Their Bodies! 24 Incredible Barely Legal Cuties! Finger-Banging Self Shot Masturbation 4 Hours

  • censoredbeautiful girlBURglay zburst graceBUR-565BUR56512bur00565
    • 2021-02-09
    128 min

    [KIRE-023]"I Don't Want To Forget The Pleasure Of Raw Sex..." Finally Ready For An On-Screen Creampie - Married Woman Happily Takes A Dom's Cum Down To Her Womb Rinka Tahara, Age 36

  • rinka tahara censoredcreampiebig titsKIREsod createevening editionbeauty kirei sodKIRE-023KIRE0231kire00023
    • 2021-02-13
    245 min

    [KDMI-032]Fucking Queen Amazing

  • maria nagai yuki god censoredcreampieKDMImiludopamixKDMI-032KDMI032kdmi00032
    • 2021-02-18
    120 min

    [TPPN-184]Incredible Orgasms - Abs Tensing With Climactic Pleasure - Sex X Oral X Fingering - 11 Loads Awakens Her Female Instinct Mahiro Ichiki

  • mahiro ichiki censoredblowjobsingle workTPPNteppanTPPN-184TPPN184tppn00184
    • 2021-02-19
    204 min

    [DOCP-275]Insta Fuck! I Couldn't Resist My Nurse's Sexy Ass! This Big Booty Nympho Was Horny For Creampie Sex And Came Hard On My Rod!

  • tsukino sakura nozomi higashi censoredcreampieuniformDOCPprestigedoc premiumDOCP-275DOCP275118docp00275
    • 2021-02-25
    50 min

    FC2PPV 1701873 Until 3/4 1980 [None] A slender black-haired beautiful girl. She can’t resist and is raped as much as she wants and is sown with her childhood.

  • amateur uncensoredfc2
    • 2021-02-26
    59 min

    FC2PPV 1697114 [Personal shooting] Nanase 24 years old, mass firing on shaved nice ass slender black gal with outstanding sensitivity

  • amateur uncensoredfc2
    • 2021-02-27
    120 min

    [JUFE-263]Beautiful Secretary With A Nice Plump Body And Colossal Tits Flaunts Her Sexual Desires And Addiction To Cock! Rui Miura

  • rui miura censoredcreampiebig titsJUFEfitchJUFE-263JUFE263jufe00263
    • 2021-03-01
    48 min

    FC2PPV 1707347 [Personal shooting / Creampie] 33-year-old wife who wants to expose her proud body Thick semen released to the back of the body awakened by a toy

  • amateur uncensoredfc2
    • 2021-03-06
    150 min

    [SHKD-930]An Aphrodisiac-Laced Full Body Erogenous Zone A Proudly Independent Female Detective Who Was Dominated Through Sex Kana Yume

  • kana yui censoredsquirtingsingle workSHKDattackersbungo maedasharkSHKD-930SHKD930shkd00930
    • 2021-03-09
    85 min

    261ARA-481 [Super SSS cute married woman] 26 years old [3rd year of marriage] Mahiro-san is here! The reason for her application as a care helper is "My husband’s earning is small … and I’m a rough chin …" Every day IR

  • amateur censoredmarried womanamateuraraara-481ara481261ara-481
    • 2021-03-21
    67 min

    490FAN-068 Mao

  • amateur censoredcreampiebig titsfanfan-068fan068490fan-068
    • 2021-03-25
    120 min

    [013ONEZ-283]媚薬キメセク アヘ顔Wピースで排卵日孕ませ援●交際 朝日しずく

  • amateur censoredcreampieuniformonezonez-283onez283013onez-283
    • 2021-03-27
    241 min

    [SGSR-276]A Secret Store？! These Adorable Girls Will Go Home With You - To Hotels For Creampie Sex - You And Cum On Their Tits And Tongues 4-Hour Special

  • censoredcreampieamateurSGSRbig morkaleigyochuushinsengumiSGSR-276SGSR27657sgsr00276
    • 2021-03-28
    58 min

    [490FAND2-1]れん 1

  • amateur censoredbig titsamateurfand2fand2-1fand21490fand2-1
    • 2021-04-02
    119 min

    [SSIS-032]The Older Female Coworker I Hate Was Secretly Working At A Super Cheap Public Brothel？! How I Turned The Tables And Shamed Her By Fucking And Deep Throating Her Tsubaki Sannomiya

  • sannomiya tsubaki censoreddeepthroatsingle workSSISs1 no 1 stylezaku araiSSIS-032SSIS032ssis00032
    • 2021-04-10
    118 min

    [BAHP-073]Trying To Get Pregnant Porn "I Just Want A Baby!" 21 Year Old Woman Orgasms With Joy As Her Pussy Is Filled With Cum

  • censoredcreampieBAHPbaltandaibutsu yoshidahoppinBAHP-073BAHP073bahp00073
    • 2021-04-15
    240 min

    [GIGL-645]Married Nurse Cheating In The Dead Of Night 3 - In-Hospital Adultery On The Night Shift 12 Girls, 4 Hours

  • censoredmarried womannurseGIGLgigoloGIGL-645GIGL645gigl00645
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-04-28
    199 min

    [HHH-229]Wife Wearing Thong With Fixed Vibrator That She Cannot Take Off - We Pretend To Help Her And Fuck Her Right Away

  • censoredamateurHHHviptriple hHHH-229HHH22978hhh00229
    • 2021-05-06
    62 min

    Caribbeancom 050621-001 A young wife who is taking out her trush sex so easy Mikuro Komori

  • mikuro komori uncensoredhandjobcaribbeancom
    • 2021-05-28
    120 min

    [WAAA-068]A Cum Bucket Girl Addicted To Creampie Sex, Who Has A Line Of Men Waiting To Fuck Her An Offensive Onslaught By Rich And Thick Dirty Old Men 20 Impregnating Cum Shots During Large Orgies Alice Nanase

  • alice nanase censoredcreampiebeautiful girlWAAAwanz factorywanzWAAA-068WAAA068waaa00068
    • 2021-06-01
    63 min

    200GANA-2488 In the spear room of the Nampa master of 100 battles, bring in SEX hidden shooting 205 Innocent Musume with a dazzling smile and drinking at home! The blow job that makes a jubojubo sound is too erotic … The beautiful body that is t

  • amateur censoredamateurganagana-2488gana2488200gana-2488
    • 2021-06-06
    67 min

    345SIMM-645 A charming and neat ponytail J ○! It depends on how you feel ♪ The sweet An An voice that leaks out as soon as you are attacked is a must-listen! !! Two barrage fires to a lovable daughter who finds happiness in sex with her uncle! [A spe

  • amateur censoredcreampieuniformsimmsimm-645simm645345simm-645
    • 2021-06-12
    132 min

    [SABA-703]Sharing A Hotel Room With My Coworker After We Went Out And Missed The Last Train... She Seemed So Unguarded, I Couldn't Resist Her... vol. 009

  • censoredcreampieuniformSABAskyu shirototodoSABA-703SABA703saba00703
    • 2021-06-29
    50 min

    10musume 062921_01 You can have a special vaginal cum shot today Emi Nishio

  • amateur uncensored10musume
    • 2021-07-14
    64 min

    SIRO-4557 [First Shot] [Beautiful Big Breasts X Momojiri] [Naka Dies Continuous Cum Daughter] Immediately After F Milk, A Professional Student Masturbates While Watching Av Every Morning And Evening Routine. Naka School Beautiful Naked Body Convulsio

  • amateur censoredbig titsamateursirosiro-4557siro4557siro-4557
    • 2021-07-31
    140 min

    [SINN-016]Married Woman Who Want To Get Pregnant! These Big Titted Voluptuous Wives Become Cum Buckets For Their Step-Son"s Bullies "Sorry...Step-Mother Has Given In To Her Desires..."

  • censoredcreampiebig titsSINNshin sekai mousozokuhitodzuma haramasetaishin seikai mousozokuSINN-016SINN016sinn00016
    • 2021-08-07
    156 min

    [MDBK-191]The 3 Slut Sisters Who Will Make You Panic By Sucking On Every Single Part Of Your Body

  • aika hikaru konno censoredcreampiebig titsMDBKk m producekuwatchibazookaMDBK-191MDBK191mdbk00191
    • 2021-08-13
    189 min

    [HUNTB-085]"Well, The Two Of You Seemed So Happy ..." Horny Nurse After Nurse, Engaged In Irreversibly Damaging Reverse NTR Filthy Sex! I Went To Be With My Wife In The Hospital During Her Pregnancy, When I Met All These Beautiful Nurses ...

  • censoredcreampieuniformHUNTBhunterkawajirihhh groupHUNTB-085HUNTB085huntb00085
    • 2021-08-16
    48 min

    IDJS-069 Ema (Mori Hinako)

  • amateur censoredcreampieamateuridjsidjs-069idjs069idjs-069
    • 2021-09-04
    179 min

    [BANS-005]Nihao Saiko 5

  • censoredcreampiecosplayBANSniihao saikou mousouzokuBANS-005BANS005bans00005
    • 2021-09-09
    43 min

    515BTGL-017 Yuka (27)

  • amateur censoredcreampiebig titsbtglbtgl-017btgl017515btgl-017
    • 2021-09-17
    124 min

    [PPPD-963]Cum Loving Slut With Soft Tits Enjoys A Titty Fuck. Total Course Of Sticky Loads For Cum Swallowing. Honoka Tsujii

  • tsujii honoka censoredbig titsslutPPPDoppaiPPPD-963PPPD963pppd00963
    • 2021-09-17
    141 min

    [JUFE-329]What"s Wrong With A Lewd Mouth？ Natural Seduction OF Male Workers In The Office! Minami Hatsukawa

  • hatsukawa minami censoredcreampieblowjobJUFEfitchJUFE-329JUFE329jufe00329
    • 2021-10-01
    48 min

    491TKWA-196 Creampie With Extreme Slender Daughter And Raw Saddle! (Hitomi Hoshitani)

  • amateur censoredcreampieuniformtkwatkwa-196tkwa196491tkwa-196
    • 2021-10-03
    58 min

    HEYZO 2631 Having Lovely Time With A Big Tits Amature Gril Vol.2 – Rie Oshima

  • rie oshima uncensoredcreampiehandjobheyzo
    • 2021-10-23
    62 min

    C0930 hitozuma1366 Hiroe Iwai 27years old

  • amateur uncensoredc0930
    • 2021-10-30
    113 min

    [XVSR-620]Slutty Masseuse Rika Aimi Kneading Nipples With Pile-Driving Pistons

  • rumi tadami censoredcreampiebig titsXVSRmax ayoshida ikuzoucalenXVSR-620XVSR620xvsr00620
    • 2021-11-02
    56 min

    FC2PPV 2398366 * For A Limited Time * Until November 4th [3000pt → 800pt] Commemorating The Renewal Of The New Manager! [Creampie Raw Squirrel] Many Riku, Re-Appearance! Innocent And Amateur Gal Sexy Maid Costume ♥ /

  • amateur uncensoredfc2
    • 2021-11-05
    162 min

    [JUL-772]Natsuki Takeuchi Releases Her First "Gokkun"! I"ve Been Made To D***k That Man"s Ugly Semen Morning, Noon, And Night. Sperm D***king "Real Sperm" X Ryo Drama

  • natsuki takeuchi censoredmature womansingle workJULmadonnatomitake taroJUL-772JUL772jul00772
    • 2021-11-13
    71 min

    230OREC-943 Aoi & Yua (Aoi Nakashiro, Rina Kawaei)

  • amateur censoredcreampieamateurorecorec-943orec943230orec-943
    • 2021-12-03
    119 min

    [MIDV-014]One Facial On Top Of Another Facial, With A Huge Load Of Spunk - Nao Jinguji

  • jinguji temple nao censoredbeautiful girlslutMIDVmoodyzoosaki hirokoujimoodyz divaMIDV-014MIDV014midv00014
    • 2021-12-06
    64 min

    SIRO-4724 [First Shot] [Muchimuchi Flesh Body] [Metamorphosis Married Woman] A Metamorphosis Married Woman Who Is An Esthetic Instructor Who Is Too Positive For Sex Appears. A Married Woman Who Is Too Erotic Shakes A Flesh Body That Is Too Obscene An

  • amateur censoredbig titsmarried womansirosiro-4724siro4724siro-4724
    • 2021-12-24
    115 min

    [OAE-213]Rainbow-Colored Platonic. Iroha Shirasaki

  • iroha shirasaki censoredsingle workOAEaircontrolsunsetleeOAE-213OAE213oae00213
    • 2021-12-24
    152 min

    [SSIS-273]3 Days With Girlfriend Out of Town. First Time For Sex In A Month Simultaneously With C***dhood Pal (Sex Friend) And Babysitter. Yura Kano

  • yura kanno censoredbeautiful girlsingle workSSISs1 no 1 styleamazing meatSSIS-273SSIS273ssis00273
    • 2021-12-30
    123 min

    [RD-1092]Showa Era Filthy And Sensual Drama. Married Woman Trying To Conceive Gets Fucked By A Hated Former Classmate That Used To Lift Her Skirt Up. Wife In Her Fifties Gives Herself Over Completely, Including Her Asshole, To Pay The Cost Of Her Deb

  • amateur censoredmarried womanblowjobRDatena eizouRD-1092RD1092
    • 2022-01-06
    75 min

    520SSK-044 Haru

  • amateur censoredcreampieuniformsskssk-044ssk044520ssk-044
    • 2022-01-11
    481 min

    [KTRA-368]Shaved Pussies! Slender Girls With Small Tits 10 Girls Fucking Nonstop! 8 Hours 2 Videos

  • atomi shuri chiaki sato censoredKTRAk tribeKTRA-368KTRA368h-094ktra00368
    • 2022-01-28
    85 min

    573DHT-0358 [Facial Deviation Value Revechi’s Icharab] Is Watered Down! [Kawaii Is Justice] The Death Face Championship Grand Prix! [Riding A Rodeo Machine] Grind Cowgirl! [Circular Up And Down ♪ Guru ♪] Cowgirl Infinite! [Ah, It ’S Amazing. You

  • amateur censoredcreampieamateurdhtdht-0358dht0358573dht-0358
    • 2022-01-30
    61 min

    544IDJS-068 Megumi [Matching App] [Chubby] [Gonzo] (Nao Kikuchi)

  • amateur censoredamateuridjsidjs-068idjs068544idjs-068
    • 2022-02-10
    65 min

    SIRO-4787 [First Shot] [Active Model] [Tall X Beautiful Breasts] A 170cm Tall Beauty Who Has Appeared In Overseas Shows And Is Active All Over The World. Her White, Transparent Skin Gradually Flushes, And Her Long, Supple Limbs Move In Pleasure. Av A

  • amateur censoredamateursirosiro-4787siro4787siro-4787
    • 2022-02-11
    120 min

    [ACZD-021]Lewd Girl With An Anal Plug That"s Always In Gets Her Pussy And Ass Fucked By 100 Guys, Leading To Her Sudden Fist Fuck Debut! Rena Asagi

  • ai kisaragi rena censoredsquirtingblowjobACZDsanwa shuppanabnormal.companiesACZD-021ACZD021h-019aczd00021
    • 2022-02-12
    120 min

    [SCD-205]A MILF Who Makes Me D***k An Aphrodisiac Is A Slut With Beautiful Big Tits - Miki Yamase

  • miki yamase censoredcreampiebig titsSCDrubykoji tsujiscoopSCD-205SCD205scd00205



    • Jav Cherry, watch JAV streaming online japanese xxx