schoolgirl high vision censored javcensored creampie




FC2ROYDDASDMIDVMIDESTARSCHRVDTTSSISHDKADASDNACRSANFSDSSAVSAGVHJUFEAUKSKBIAUKGNATR

2020-12-11
128 min

[SCPX-415]Strip Club New Meguro DX: Secret Fucking And Cumshot Service: Winter 2020 Performance

  • censoredbig titsblowjobSCPXscoopmousouzokuSCPX-415SCPX415h-565scpx00415
    • 2020-12-17
    91 min

    [KEED-063]My Girlfriend's Mom Started Luring Me To Creampie Temptation In Her Erotic Lingerie Akari Nagano

  • akari nagano censoredcreampiemarried womanKEEDcenter villagekotaro misatohanazono center villageKEED-063KEED063h-086keed00063
    • 2020-12-31
    135 min

    [JUL-432]My Father-In-Law Got Banned From The Local Brothel, So Now He's Turned To Me For Creampies... Himari Kinoshita

  • himari kinoshita himari hanazawa censoredmature womansingle workJULmadonnahiroyuki kimuraJUL-432JUL432jul00432
    • 2021-01-10
    152 min

    [CESD-964]Tsugumi Mizusawa Finally Ready For Her First Lesbian Experience - Her Girl-On-Girl Three-Some Lesbian Lust Awakening Tsugumi Mizusawa Rena Aoi Mihina

  • tsugumi mizusawa blue censoredlesbianmature womanCESDceleb no tomoCESD-964CESD964cesd00964
    • 2021-01-15
    17 min

    FC2PPV 1646343 [Limited quantity] Shaved girl special [Super rare]

  • amateur uncensoredfc2
    • 2021-01-17
    31 min

    FC2PPV 1648619 [New] [Until January 24, 1900pt → 1500pt] Gonzo with a 21-year-old erotic nursery teacher! !! The chestnut and the inside are rolled up with an erogenous zone!

  • amateur uncensoredfc2
    • 2021-01-23
    119 min

    [DASD-807]His And Her Orgasms - My Buddy's (Hot) Older Sister Punched My V-Card Aya Mamiya

  • aya mamiya censoredcreampieslutDASDdasinaballDASD-807DASD807dasd00807
    • 2021-01-27
    52 min

    FC2PPV 1661503 [Uncensored / Individual shooting] SEX for the first time in a year! Blow that is too erotic though it is an amateur ❤ Hairless Ma ○ Ko of shaved bread is sloppy ❤ * With review benefits!

  • amateur uncensoredfc2
    • 2021-02-10
    31 min

    FC2PPV 1680576 Limited to 3 days [Individual] In order to collect a large amount of debt, I rushed to the house and made another stick sucked in the mouth and drooled and made a large amount of vaginal cum shot

  • amateur uncensoredfc2
    • 2021-02-27
    66 min

    H4610 ki210228 Mirai Momoi 27years old

  • amateur uncensoredh4610
    • 2021-02-27
    118 min

    [MIMK-085]Having Sex With My Super Capable Married Female Coworker On Our Business Trip! She's Always Really Serious And Scary But This Time She's Just A Woman - JULIA

  • julia censoredcreampiebig titsMIMKmoodyzkitorune kawaguchimankitsuMIMK-085MIMK085mimk00085
    • 2021-03-05
    242 min

    [HEZ-256]Please Introduce Me To Your Friend - I Hear She's Even Freakier Than You! 4 Any Nympho's Friend Has Got To Be A Slut Too! No Matter Who's Watching, No Matter How Many Rounds You Want To Go, These Sluts Are Always Down To Fuck!

  • censoredbig titssquirtingHEZhot entertainmentmadoka ikkihotHEZ-256HEZ25659hez00256
    • 2021-03-06
    119 min

    [JUL-501]I Am Bullied And Want To Fuck My Classmate's Mom Tsubaki Kato

  • kato camellia kaoru natsuki censoredmature womanmomJULmadonnajyoji kawaiJUL-501JUL501jul00501
    • 2021-03-14
    73 min

    428SUKE-064 [Half Gal x Dance x Sex] Only the black gal won! !! Filipino half pie bread dancer appeared! Trained belly circumference! The waist is erotic! Sex dance regardless of sofa, stairs, location ☆ Party held www [NO.5 Sara]

  • amateur censoredcreampiebig titssukesuke-064suke064428suke-064
    • 2021-03-15
    244 min

    [NPS-410]A Real Pickup! This Blatantly Erotic Girl Gets Teased x 2 And Now The Horniness Just Won't Stop! She's Begging For Piston-Pounding Thrusts! 111 Orgasms 15 Ejaculations!

  • censoredcreampieamateurNPSpeterskensuke kikuchinampazuNPS-410NPS410h-021nps00410
    • 2021-03-18
    58 min

    Pacopacomama 031821_448 Fucking While Calling Hubby: Hentai wife hungry for sex Mikako Tachibana

  • amateur uncensoredpacopacomama
    • 2021-03-20
    244 min

    [SGKX-001]Cut Girl Gram #001 (Hopping From One Girl To Another Documentary)

  • censoredbig titsSGKXhame chanhajime yanaigal suta gramSGKX-001SGKX001h-1575sgkx00001
    • 2021-03-23
    43 min

    H4610 ki210323 Yukari Kitagawa 20years old

  • amateur uncensoredh4610
    • 2021-03-30
    59 min

    492JCHA-047 Feeling tons？ Feeling tons？ Doya Erotic Masaya 2

  • amateur censoreduniformschoolgirljchajcha-047jcha047492jcha-047
    • 2021-04-07
    120 min

    [MSA-011](Amateur Videos) (Creampie Raw Footage) 11 Tomoka (21 Years Old) Is A Shaved Pussy Babe She's Using Her Pussy's Sensors To Search Out Cocks And Spreading Her Legs For Some Big Time Fucking! She Kept On Screaming, "This Feels So F

  • amateur censoredcreampieuniformMSAfuturefuture futureMSA-011MSA011
    • 2021-05-07
    119 min

    [IPX-661](Complete Corruption.) Busty Wife Cheats With Her Hung Personal Trainer - Adultery On The Clock Tsubasa Amami

  • amami tsubasa censoredcreampieblowjobIPXidea pocketinaballdishIPX-661IPX661ipx00661
    • 2021-05-08
    130 min

    [CEMD-005]Squirting Is How Lesbians Show Their Love. Girl On Girl Gushing: Mihina Hina Kanno

  • mihina azumihina mihina nagai jinno hina censoredsquirtinglesbianCEMDceleb no tomoCEMD-005CEMD005cemd00005
    • 2021-05-11
    61 min

    HEYZO 2528 Beautiful Girl’s After School Life No.36 -Enjoying A Girl’s Body In Short Skirt- – Kurumi Tokito

  • kurumi tokito uncensoredcreampieheyzo
    • 2021-05-15
    61 min

    1Pondo 051521_001 Seducing by Flashing Pussy: Miyu Morita

  • amateur uncensored1pondo
    • 2021-05-15
    62 min

    HEYZO 2526 Foursome Fantasy With A Porcelain Skin Girl! – Sakura Kozima

  • sakura kozima uncensoredcreampieheyzo
    • 2021-05-21
    60 min

    230OREC-767 Arisa-san

  • amateur censoredcreampiebig titsorecorec-767orec767230orec-767
    • 2021-05-22
    240 min

    [ENKI-037]Suzuka-chan Is An Extremely Shy And Bashful Girl Who Talks So Quietly That You Can Barely Hear Her, But It Turns Out That This Secretly Horny And Perverted Babe Has An Extremely Powerful Sexual Appetite! A Discourse Involving The Creampie R

  • censoredcreampieENKIpoisonous banquetENKI-037ENKI037enki00037
    • 2021-05-22
    141 min

    [APAK-194]"I'm Your Pet!" Breaking In The New Secretary: She Couldn't Refuse This Hot Spring Vacation, And Things Escalated From There Into Obedience Training Jun Harumi

  • jun shunmei censoredcreampiedeepthroatAPAKaurora project annexrkaurora project anexAPAK-194APAK194apak00194
    • 2021-05-26
    120 min

    [C-2640]My Wife's Friend Was Going To Spend The Night At Our Place "Her Name Is Misuzu-san (Not Her Real Name), She's A Married Woman, 30 Years Old" So Naturally, I Took Advantage Of The SItuation

  • censoredmarried womanamateurCgogoskoichi takahashicore gogo sC-2640C2640
    • 2021-05-28
    118 min

    [WAAA-069]This Super Sexy Lady Boss Planned For Us To Be Booked Into The Same Room Together So She Could Suck My Cock And Hit Me With Reverse NTR Action She Pressed Her Voluptuous Big Titties And Ass Into Me For A Creampie Fuck Fest And Sucked 10 Eja

  • nene tanaka censoredcreampiebig titsWAAAwanz factorywanzWAAA-069WAAA069waaa00069
    • 2021-06-12
    242 min

    [UMSO-397]We Make A Chubby Married Woman Wear A Costume, Fuck Her Hard And Creampie Her

  • yuri chitose mizuna wakatsuki censoredcreampiebig titsUMSOk m produceumanamiUMSO-397UMSO397umso00397
    • 2021-06-17
    65 min

    FCP-024 [Delivery only] Completely subjective! !! G cup or more that completely wraps Ji ● Ko … Superb big tits fucking ＃ 4

  • amateur censoredbig titsamateurfcpfcp-024fcp024fcp-024
    • 2021-06-25
    48 min

    HEYZO 2565 POV Fuck Option With Rookie Call Girl Plus Creampie For Free – Miss Deli Yuka

  • derijyouyuka uncensoredheyzo
    • 2021-06-26
    55 min

    H4610 ki210627 Chinatsu Kitada 29years old

  • amateur uncensoredh4610
    • 2021-07-02
    160 min

    [JUL-644]Yuko Shiraki Adult Style Skills Honed By Years Of Experience Documentary Drama Featuring Actress Yuko Shiraki

  • shiraki yuko censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-644JUL644jul00644
    • 2021-07-15
    74 min

    200GANA-2520 Seriously Nampa, First Shot. 1662 Interview With A Sleeveless Older Sister With Beautiful Legs, "where Are You Having An Affair？" Naturally, The Investigation Goes In The Erotic Direction … The Voice Of A Beautiful Woman Of

  • amateur censoredamateurganagana-2520gana2520200gana-2520
    • 2021-07-17
    238 min

    [CJOB-091]Squeezing Out Your Cum In Her Mouth And Pussy! The Most Erotic Gal In The World! BEST

  • aika natsuho imai censoredcreampieblowjobCJOBchijo heavenslut heaven bestCJOB-091CJOB091cjob00091
    • 2021-07-18
    238 min

    [OKAX-759]Rock Hard And Sensitive! An Erotic Elder Sister Type Will Give Your Nipples Relentless Love And Foreplay And Get You Erect And Ecstatic, And Then She'll Get Your Cock Squirting And Ejaculating!

  • yuki sakuragi yui kawagoe censoredslutOKAXk m produceokazuOKAX-759OKAX759okax00759
    • 2021-08-05
    239 min

    [FANK-001]Fuckstagram - Wild MILFs With Colossal Tits Edition

  • censoredcreampieamateurFANKcubefank 99.comFANK-001FANK001h-1593fank00001
    • 2021-08-06
    155 min

    [JUFE-317]My Wife Went To Visit Her Hometown For 7 Days, Leaving Me All Alone With My Stepdaughter - Who Sure Is Growing! A Record Of How She Whipped Out Her Colossal Tits, Sweat-Slicked And Bouncing While We Banged Until She Told Me She Loved Me Ren

  • reina taoyuan censoredcreampiebig titsJUFEfitchJUFE-317JUFE317jufe00317
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-17
    62 min

    FC2PPV 2213573 [Uncensored] Tokyo Metropolitan Nursing / Nurse Clothes Creampie Raw Gonzo! 19 Years Old: Nursing Student

  • amateur uncensoredfc2
    • 2021-10-07
    130 min

    [STARS-469]超世話焼き姉ちゃんが弟クンの包茎チ〇ポの悩みにぜ～んぶ答えちゃう 夏目響

  • natsume hibiki censoredbig titssoloworkSTARSsod createtaiga kosakaisod starSTARS-469STARS469
    • 2021-10-07
    119 min

    [AARM-023]She Rode Me Hard And Showered Me With French Kisses While Trapping My Cock In Between Her Thighs And Continuously Twisting And Tweaking My Dick Tip With Her 2 Fingers

  • natsuki shiori tsukada censoredhandjobAARMaroma kikakukadowaki shigeoaromaAARM-023AARM023aarm00023
    • 2021-10-22
    240 min

    [CJOB-098]Pleasure Triangle Fainting In Agony 3! Slut Harem BEST

  • ichika matsumoto satoshi kuruki censoredblowjobslutCJOBslut havenslut haven bestCJOB-098CJOB098cjob00098
    • 2021-10-22
    180 min

    [HUNBL-066]Step Mother Held For Her Son" Sake

  • censoredcreampieHUNBLhuntergeminihhh groupHUNBL-066HUNBL066hunbl00066
    • 2021-10-22
    155 min

    [SSIS-221]Dressed Big Tits That Seduce Men U*********sly. Lucky Situations Dreams Special. Uta Hayano

  • hayano uta censoredbig titssingle workSSISs1 no 1 stylekyouseiSSIS-221SSIS221ssis00221
    • 2021-10-25
    59 min

    541AKYB-038 Megu (24) Pursuit Blow From Creampie To National Treasure Class G Breast Girl (Megu Mizumori)

  • amateur censoredcreampiebig titsakybakyb-038akyb038541akyb-038
    • 2021-10-27
    53 min

    [ETQR-303][Daydream POV] Raw Sex With Beautiful Girl In Sailor Uniform. Yukino

  • censoredcreampieuniformETQRerotic timeETQR-303ETQR303etqr00303
    • 2021-11-11
    56 min

    435MFC-158 [Hentai Slut Menes Miss Production Ok] Gonzo With Arasa Girls "Minna" Working At Popular Men’s Esthetics! In Addition To The Production Ok, The Repeat Of The Customer Does Not Stop With God Erotic Tech! ？？ [Shiroto Gonzo ＃ Eve

  • amateur censoredcreampiebig titsmfcmfc-158mfc158435mfc-158
    • 2021-12-03
    80 min

    393OTIM-097 [Delusional Subjectivity] Sexual Intercourse With A Beautiful Girl With Big Tits Rina Takase

  • amateur censoredcreampiebig titsotimotim-097otim097393otim-097
    • 2021-12-04
    121 min

    [BKD-273]Family Fun [Higashi Nikko Kurotakiyama Road] Sakura Tsukijima

  • tsukishima sakura censoredcreampiemature womanBKDrubytsuji koujitabijiBKD-273BKD273bkd00273
    • 2021-12-06
    58 min

    544IDJS-083 Shoko (48) [Married Woman] [Creampie] (Shoko Tokuyama)

  • amateur censoredcreampiemarried womanidjsidjs-083idjs083544idjs-083
    • 2021-12-27
    66 min

    481SACZ-103 Fumiko Miyake / Nagisa

  • amateur censoredmarried womanamateursaczsacz-103sacz103481sacz-103
    • 2021-12-31
    61 min

    [123121-001]Getting Up Sensitive Masochist Nipples 15

  • miyu morita uncensoredcreampiehandjobcaribbeancom
    • 2022-01-16
    61 min

    345SIMM-688 [Paipan] [Beautiful Big Tits Pink Nipples] Color Black And White Hair A Neat And Clean Tennis Club Deputy Director’s Honor Student Challenges Gonzo Compensated Dating! #Uniform #Raw Legs #Slender #Beautiful Ass #Beautiful Legs #Rotor

  • amateur censoredbig titsuniformsimmsimm-688simm688345simm-688



    • Jav Cherry, watch JAV streaming online japanese xxx