school uniform schoolgirl javcensored high vision jav




FC2CJODBLKIPXMILKAVSAMEYDSTARSADNMIDEDTTNNPJAMBIPREDNACRAWDMARAMVSDHZGDCAWDKSBJ

2018-12-20
210 min

[DANDY-639]"When An Innocent Schoolgirl Finds A Man Handcuffed With The Key Tied Around His Cock, Can The Schoolgirl Resist Being Turned On When His Dick Becomes Hard？" vol. 1

  • censoredschoolgirlDANDYdandyparsley okamotoDANDY-639DANDY6391dandy00639
    • 2018-12-16
    167 min

    [DASD-490]Uniform Boy Suzuka Tsukimi

  • tsukimi suzuka censoredschoolgirlbeautiful girlDASDdasnao masakiDASD-490DASD490dasd00490
    • 2018-12-14
    122 min

    [SCOP-584]"No One Told Me I'd Be Getting Fucked Raw!" This Schoolgirl Was Accidentally Raw Fucked When My Rubber Slipped Off, And She's Thrilling To The Pleasure Of Her First Raw Cock Sensation, And Now She's Begging For More Crea

  • censoredcreampiebig titsSCOPscoopbacon tanakamousouzokuSCOP-584SCOP584h-565scop00584
    • 2018-12-13
    146 min

    [AP-611]Nipple & Clit Twisting Sensitive Train Molestation 3

  • censoredschoolgirlAPapachemasanorihhh groupAP-611AP611ap00611
    • 2018-12-12
    238 min

    [FNEO-002]"What？ Isn't This Sex？" Schoolgirls Get Their Pussies Teasingly Rubbed With A Bare Dick And Are Made To Orgasm Repeatedly. When The Cock Is Slipped Inside Their Pussies They Can't Refuse And Continue To Move Their Hips

  • censoredcreampiesquirtingFNEOfirst starfirst star neoFNEO-002FNEO002h-491fneo00002
    • 2018-12-07
    144 min

    [PKPD-040]Paid Dating. A Plain, Bespectacled Girl With Secretly Big Tits. Filming OK. Real Paid Dating. A Middle-Aged Man Gets The Girl All To Himself. Rena Takamure

  • rejoice censoredschoolgirlsingle workPKPDpakopakodan to yukaina nakamatachihhh groupPKPD-040PKPD040pkpd00040
    • 2018-12-06
    119 min

    [SSNI-363]A Schoolgirl In Uniform Gets Raped. Azusa Oto. ~The Fate of A School Idol Desperate To Keep A Secret~ Azusa Oto

  • sound azusa censoredbeautiful girldeepthroatSSNIs1 no 1 stylejo styleSSNI-363SSNI363ssni00363
    • 2018-12-06
    198 min

    [SW-599]My Little Sister And Her Friend Wanted To Become Youtubers And Earn Some Money, So They Were Filming Naughty Videos. But They Ended Up Doing Naughty Experiments With Me That Led To Us Fucking So We're Releasing It As Porn.

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-599SW5991sw00599
    • 2018-12-06
    305 min

    [HUNTA-526]"We Used To Hide Under The Covers When We Were Kids, Right!？ It's Kind Of Exciting To Do It Now..." Passionately French Kissing My Childhood Friend Under The Covers!! From Kindergarten All The Way Up To High School, My Childhoo

  • censoredcreampieschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-526HUNTA526hunta00526
    • 2018-11-27
    147 min

    [FONE-029]Videos Of Runaway Girls Who Go From One Middle-Aged Man's Home To The Next Are Released By A Network Of Men Who Prey On Runaways. She's A Plain Girl With Black Hair But Her Body And Tan Lines Are Hot. Video OK, Creampie OK. Anything

  • censoredcreampieschoolgirlFONEfirst stardiscoveryFONE-029FONE029h-491fone00029
    • 2018-11-27
    145 min

    [FNEO-001]Color Me With Your Love Sex Isn't Just About Sticking It In... Rion Izumi

  • rion izumi censoredschoolgirlsingle workFNEOfirst starhiromichi hosefirst star neoFNEO-001FNEO001h-491fneo00001
    • 2018-11-27
    235 min

    [MEKI-007]"She Can't Possibly Say No..." She Came To This Massage Parlor To Elevate Her Womanhood, And Quickly Got Seduced By The Male Therapist Into Giving Her Body Over To Sexual Pleasures This Is What Happens When A Beautiful Young Gir

  • censoredcreampiesquirtingMEKImercuryultimate planMEKI-007MEKI007h-1133meki00007
    • 2018-11-24
    123 min

    [EIKI-085]If Her Parents See This Video, They'll Cry. Their Beloved Daughter Is Getting Fucked By Her Private Tutor And Enjoying It... Cumming On The Tongue Of A Neat And Clean Girl & Perverted Creampie Sex. Yui Miho

  • miho yui censoredschoolgirlsingle workEIKIbig morkaleikiEIKI-085EIKI08557eiki00085
    • 2018-11-23
    260 min

    [MDTM-446]Uniform Schoolgirl First Squirting After School... 4 Hours

  • censoredcreampiesquirtingMDTMmedia stationuchu kikakuMDTM-446MDTM44661mdtm00446
    • 2018-11-23
    116 min

    [HND-601]The Barely Legal Who Could Stop Time She's Stopping Time So That She Can Have One-On-One Deep And Rich Creampie Sex With Her Favorite Boy Nao Jinguji

  • jinguji temple nao censoredcreampieschoolgirlHNDhon nakatiger kosakaiHND-601HND601hnd00601
    • 2018-11-23
    251 min

    [OKAX-451]There Are No Rules At This Naughty Reflexology Parlor Filled With Girls In Uniforms! 4 Hours

  • censoredbig titsschoolgirlOKAXk m produceokazuOKAX-451OKAX45184okax00451
    • 2018-11-23
    238 min

    [MDTM-447]Super Horny Girls from an Elite Girls School Show Us Their True Colors 04

  • censoredcreampieschoolgirlMDTMmedia stationsuginokiuchu kikakuMDTM-447MDTM44761mdtm00447
    • 2018-11-22
    254 min

    [PIYO-013][Download Only Bonus Feature Included] Giving A Barely Legal Girl Creampies Without Her Permission. Pussy Bukkake. Fucking Sisters Until Cum Turns Into Meringue (Pseudonym)

  • censoredcreampieschoolgirlPIYOhyokopiero dagrey wolfPIYO-013PIYO0131piyo00013
    • 2018-11-22
    100 min

    [IENE-946]Nanako Miyamura A Newly Wed Lifestyle Of Babymaking Sex With A Student

  • nanako miyamura censoredschoolgirlsingle workIENEienergytiger kosakaiie nergyIENE-946IENE9461iene00946
    • 2018-11-22
    136 min

    [NHDTB-206]Forcibly Fucked While Holding In Her Pee! Schoolgirls Tremble And Piss Themselves From The Pleasure 4. My Bratty Little Sister... Incest Special

  • censoredschoolgirlsisterNHDTBnatural highhopeless dainanaNHDTB-206NHDTB2061nhdtb00206
    • 2018-11-17
    166 min

    [OYC-217]The Girls' Bathroom Near The Gym Was A Secret Spot For Bitches To Get Sexual Relief! I Needed To Piss! And I Ran To The Girls' Bathroom! I Knew I Made A Mistake, But I Could Hear Sexy Moaning From The Next Stall And There, I Saw A Bo

  • censoredschoolgirlblowjobOYCoyashoku.companyspace nyanjirohhh groupOYC-217OYC217oyc00217
    • 2018-11-17
    232 min

    [ATOM-353]Squeezing Their Tits! Rubbing Their Asses! Schoolgirls Only! Guess Which Molester Touched You! "Who Is The Molester" Quiz

  • censoredschoolgirlATOMatomwhatta gianthhh groupATOM-353ATOM353atom00353
    • 2018-11-16
    210 min

    [DOCP-107]My Friend's JK Little Sister Was Smiling Devilishly As She Lured Me To Temptation With Panty Shot Action! She Gave Me A Furious Face Ride With Her Musty Panties And Then She Teased Me With A Horny Hot Dogging Session...

  • yui natsuhara suzu yamai censoredschoolgirlbeautiful girlDOCPprestigedoc premiumDOCP-107DOCP107118docp00107
    • 2018-11-10
    160 min

    [MIDE-597]My Big Sister Was Forced To Become A Student Again When She Was Caught Cheating On Her Academic Records Shoko Akiyama

  • shoko akiyama censoredschoolgirlsisterMIDEmoodyzwild sevenmoodyz divaMIDE-597MIDE597mide00597
    • 2018-11-09
    151 min

    [MDB-953]Miniskirt Thong Schoolgirl

  • akemi miu seirang igarashi censoredcreampieschoolgirlMDBmedia stationk tarobazookaMDB-953MDB95361mdb00953
    • 2018-11-09
    146 min

    [MDTM-444]I Love My Big Brother-In-Law So Much I'm Fucking Him All The Time Yui-chan

  • censoredcreampieschoolgirlMDTMmedia stationdokujiuchu kikakuMDTM-444MDTM44461mdtm00444
    • 2018-11-09
    136 min

    [MDTM-440]My Very Own Schoolgirl Idol Who Will Let Me Creampie Her Anytime Lilina Yamaoka

  • rina yamaoka censoredcreampieschoolgirlMDTMmedia stationsuginokiuchu kikakuMDTM-440MDTM44061mdtm00440
    • 2018-11-09
    120 min

    [MDTM-438]I'm The Victim Of Pranks Pulled By The Big Brother From Next Door... Mai Imai

  • mai imai censoredcreampieschoolgirlMDTMk m producetokonoma jouzuMDTM-438MDTM43861mdtm00438
    • 2018-11-09
    238 min

    [SIM-006]"Am I A Maso Bitch？" This Uniform Wearing JK Is Having Sexual Problems And Has Decided To Take On Her First S&M Vibrator Experience! She's Getting Tied Up In Humiliating Fashion And Unable To Move As She Gets Her JK Pussy Fitt

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-006SIM006118sim00006
    • 2018-11-08
    101 min

    [GS-223]A Sexy Girl Starts Masturbating With Her Mom's Sex Toys While Her Parents Are Out! Unaware Of What's Happening, I Drop By And Notice The Front Door Is Open... Unable To Call Out, I Just Watch Her Orgasming Passionately!!

  • censoredschoolgirlGSsosoru x garconjulianoGS-223GS2231gs00223
    • 2018-11-08
    141 min

    [MIST-235]The Special Service At The Schoolgirl Observation Club 4. Yui Tomita

  • yu tomita censoredschoolgirlsingle workMISTmr michirusaitaMIST-235MIST2351mist00235
    • 2018-11-03
    181 min

    [AP-597]When We Got Caught In A Sudden Rainstorm, My Classmate And I Got Soaking Wet, And I Got Excited Seeing Her Grownup Underwear Through Her Wet Clothes, And I Could No Longer Resist, So I Pumped Her Pussy With Hard Stroking Thrusts Over And Over

  • censoredcreampieschoolgirlAPapachekuniokahhh groupAP-597AP597ap00597
    • 2018-11-02
    135 min

    [HODV-21334]Full-Booty Panty Shot Show and the Total Domain Between Micro-Miniskirt and Knee-High Stockings The Tiniest, Cutest Classmate Kanon Momojiri

  • momojiri kanon censoredschoolgirlsingle workHODVh m pbottomsHODV-21334HODV2133441hodv021334
    • 2018-11-02
    490 min

    [DCX-088]Real Document Plus BEST 04

  • censoredcreampieschoolgirlDCXprestigedoc maxDCX-088DCX088118dcx00088
    • 2018-10-29
    146 min

    [JUTN-010]An Aggressive Schoolgirl Who Loves Middle-Aged Men And A Middle-Aged Man Who Loves Barely Legal Girls. Shuri Atomi

  • atomi shuri censoredcreampieschoolgirlJUTNjumpjump avJUTN-010JUTN010h-227jutn00010
    • 2018-10-27
    130 min

    [MEKI-006]I Was Watching My Big Brother Enjoy Masturbation While Watching VR Videos, And His Dick Got Bigger And Bigger, And I Started To Feel Sexy, And So I Teased Him... And Then I Ended Up Having Real Sex With My Big Brother

  • censoredschoolgirlsisterMEKImercuryMEKI-006MEKI006h-1133meki00006
    • 2018-10-26
    157 min

    [MDTM-432]A Young High Schooler Idol Who'll Let Me And Only Me Creampie Her - Akeemi

  • akemi miu censoredcreampieschoolgirlMDTMmedia stationani nakamurauchu kikakuMDTM-432MDTM43261mdtm00432
    • 2018-10-26
    239 min

    [MDTM-433]Super Horny Girls from an Elite Girls School Show Us Their True Colors 03

  • censoredcreampieschoolgirlMDTMmedia stationsuginokiuchu kikakuMDTM-433MDTM43361mdtm00433
    • 2018-10-26
    132 min

    [MDTM-434]My Brother-In-Law Is So Hot, I Just Have To Fuck Him. Natsuki Minami

  • south natsuki censoredschoolgirlsisterMDTMmedia stationdokujiuchu kikakuMDTM-434MDTM43461mdtm00434
    • 2018-10-26
    240 min

    [MDTM-430]Schoolgirls On The Way Home - After School Creampie Casual Job - 4 Hours

  • censoredcreampieschoolgirlMDTMmedia stationuchu kikakuMDTM-430MDTM43061mdtm00430
    • 2018-10-25
    245 min

    [NHDTB-191]Unable To Raise Her Voice On A Night Bus, A Girl Is Made To Orgasm And Gets Fucked Slowly Until She Loses Her Mind. She Doesn't Even Resist Getting Creampied. Schoolgirls Only 2. Hip-Thrusting Lust Special

  • censoredcreampiebig titsNHDTBnatural highjanken kotamaNHDTB-191NHDTB1911nhdtb00191
    • 2018-10-25
    145 min

    [NHDTB-194]Solicited By An English School... And Fucked Right Away By A Black Man! A Schoolgirl Experiences Continuous Orgasms For The First Time In Her Life

  • censoredschoolgirlNHDTBnatural highhopeless dainanaNHDTB-194NHDTB1941nhdtb00194
    • 2018-10-25
    168 min

    [NHDTB-193]The Attack Of The Aphrodisiac-Squirting Strap-on Dildo 2. The Pleasure Of Being Creampied By A Woman Makes A Schoolgirl Lose Her Mind And Become A Lesbian

  • censoredschoolgirllesbianNHDTBnatural highmaki peyangNHDTB-193NHDTB1931nhdtb00193
    • 2018-10-21
    119 min

    [KAWD-945]The Gang Rape And Molestation Of An Idol In Uniform. Relentless Gang Banging On A Crowded Train Makes Her Orgasm Till She Collapses. Mei Tachibana

  • mei tachibana censoredschoolgirlsingle workKAWDkawaiikyoseiKAWD-945KAWD945kawd00945
    • 2018-10-21
    148 min

    [KAWD-941]Perverted And Dirty Sex With A Middle-Aged Man On The Day Of Meeting. Moko Sakura

  • sakura moko censoredschoolgirlsingle workKAWDkawaiimon cKAWD-941KAWD941kawd00941
    • 2018-10-21
    120 min

    [KAWD-946]The Beautiful, Seductive Girl Who Tempts Me By Flashing Her Panties At Me. Ruru Arisu

  • have censoredschoolgirlslutKAWDkawaiigoemonKAWD-946KAWD946kawd00946
    • 2018-10-19
    146 min

    [LZDM-020]A Schoolgirl Teases A Female Teacher. Naughty Lesbians Living Together Vol. 02 ~Their Very First One-On-One Lesbian Lesson~ Mari Takasugi, Yui Miho

  • mari takasugi miho yui censoredschoolgirllesbianLZDMlesrewild sevenlezure dramaLZDM-020LZDM020lzdm00020
    • 2018-10-13
    127 min

    [APNS-086]A Young Girl In Uniform With An Exhibitionist Fantasy. Maina Miura

  • mai minamata censoredcreampieschoolgirlAPNSaurora project annexyukihiro nasuaurora project anexAPNS-086APNS086apns00086
    • 2018-10-13
    240 min

    [BDSR-366]Sexy Mischief Manual - You Shoulda Gone To School... 12 Damaged Young Women

  • censoredschoolgirlamateurBDSRbig morkalyokohachibigmorkalBDSR-366BDSR36657bdsr00366
    • 2018-10-12
    151 min

    [MDB-941]Creampie With Excuses - High School Girl

  • tamaki walnut rina minami censoredcreampieschoolgirlMDBmedia stationk tarobazookaMDB-941MDB94161mdb00941
    • 2018-10-12
    158 min

    [MDTM-429]Creampie Raw Footage With My Student On A Hot Spring Trip - Sayu-chan - Sayu Ukita

  • ukida censoredcreampiebig titsMDTMk m produceuchu kikakuMDTM-429MDTM42961mdtm00429
    • 2018-10-11
    155 min

    [SW-586]I'm Going To Roast You Like A Pig! A Glaring Delinquent Schoolgirl And Me. But She's Really Cute And She Gets All Sweet When She's Alone. She's Really A Sheep In Wolf's Clothing And She Can't Say No To Pleasure.

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-586SW5861sw00586
    • 2018-10-11
    214 min

    [NHDTB-187]Three High School Girls Cum While Playing With Their Nipples In Secret Places! Public Toilets, Video Game Arcades, Boiler Rooms And Bike Parking Lots

  • censoredsquirtinguniformNHDTBnatural highbacon tanakaNHDTB-187NHDTB1871nhdtb00187
    • 2018-10-07
    216 min

    [HUNTA-502]I Can't Believe I'm Living Together With My Cousin Who Ran Away From Home？ I'm Not Used To Living Together With A Girl, And Now I Can't Masturbate With Her Around So My Crotch Is About Ready To Explode! But Then... I Live A

  • censoredschoolgirlhandjobHUNTAhuntercognac kaminohhh groupHUNTA-502HUNTA502hunta00502
    • 2018-10-07
    141 min

    [PKPD-037]Paid Dating. A Student Gal With A Hot Body Who Was Once In The Swimming Club. Filming Ok. Real Paid Dating. A Middle-Aged Man Has The Boycotted Girl All For Himself. Rin Sahara

  • sakihara rin censoredcreampieschoolgirlPKPDpakopakodan to yukaina nakamatachihhh groupPKPD-037PKPD037pkpd00037
    • 2018-10-07
    223 min

    [HUNTA-501]This Naive Girl Said That She Was A Slut, So When I Egged Her On, I Was Able To Fuck Her! There's This Bitchy Girl In My Class Who Pretends To Be A Slut But Even A Cherry Boy Like Me Can Tell That She's Not Really A Slut She Kept O

  • censoredschoolgirlHUNTAhuntermorikihhh groupHUNTA-501HUNTA501hunta00501



    • Jav Cherry, watch JAV streaming online japanese xxx