school uniform jav def over hours javcensored




FC2HZGDDASDNNPJADNMIAASHKDHMNDASDNACRAWDSQTEMIDEVENUVENXKBISSNISTARSVEMAJUFEAPOD

2018-07-13
239 min

[GNE-207]A Totally Beautiful Girl Gives The Ultimate Cherry Popping 2

  • sonoda mio kaname censoredbeautiful girlGNEgallopneo giftGNE-207GNE207h-479gne00207
    • 2018-07-06
    240 min

    [ONEZ-150]# This Beautiful Girl Who Looks Way Too Good In Uniform Is My Girlfriend Memorial Complete Best 4 Hours

  • censoredcreampiebeautiful girlONEZprestigeonezONEZ-150ONEZ150118onez00150
    • 2018-07-06
    483 min

    [CDC-002]Picking Up Girls And Finding Beautiful Babes With Short Hair And Incredibly Translucent Skin 40 Girls

  • censoredbeautiful girlCDCprestigecross docCDC-002CDC002118cdc00002
    • 2018-06-22
    253 min

    [BAZX-141]Total Domain: Knee-high maniacs 2

  • censoredcreampieschoolgirlBAZXmedia stationone topbazookaBAZX-141BAZX14161bazx00141
    • 2018-06-22
    479 min

    [BAZX-140]I Want To Fuck This Girl Complete Memorial Best Collection 24 Girls/480 Minutes

  • censoredamateurblowjobBAZXmedia stationbazookaBAZX-140BAZX14061bazx00140
    • 2018-06-22
    241 min

    [MDTM-378]Our Super Idol, Aya Sazanami! 4 Hours

  • censoredschoolgirlMDTMmedia stationspace planningMDTM-378MDTM37861mdtm00378
    • 2018-06-21
    281 min

    [SVDVD-669]Shame This New Student Is Coming In For A Medical Checkup, And We Found Out She's Still Growing! 2018 Early Summer

  • censoredSVDVDsadistic villagenew kazi kazamaSVDVD-669SVDVD6691svdvd00669
    • 2018-05-25
    240 min

    [OKAX-375]After School Babes And Lewd Molesters 4 Hours

  • censoredschoolgirlbeautiful girlOKAXkm producedick poisonside dishesOKAX-375OKAX37584okax00375
    • 2018-05-25
    241 min

    [OKAX-383]This Is The Truth! Real Sex With Schoolgirl Babes Who Work At Underground Sex Clubs! 4 Hours

  • censoredcreampieschoolgirlOKAXkm produceside dishesOKAX-383OKAX38384okax00383
    • 2018-04-27
    241 min

    [MDTM-355]Horny Schoolgirl Babes Domesticated Through Creampie Sex 4 Hours

  • censoredcreampieschoolgirlMDTMmedia stationspace planningMDTM-355MDTM35561mdtm00355
    • 2018-04-12
    241 min

    [FSKT-038]The Beautiful Girl Student We Found at the Laundromat Was Mihina Nagai. Four Hours Total With Other School Girls in Uniform

  • azumihina nagai mihina censoredbig titsschoolgirlFSKTfirst starsummaryFSKT-038FSKT038h-491fskt00038
    • 2018-04-06
    231 min

    [TWT-022]Excessively Erotic Panty Shot Temptation From Girls In Uniform 3 Hours 51 Minutes/11 Girls Greatest Hits Collection

  • censoredschoolgirlTWTsartre video publishingtwin tailsTWT-022TWT022h-897twt00022
    • 2018-04-06
    484 min

    [DCX-078]I Know We're Friends, But It's Just For The Money, So Please Have Sex With Me!! Uniform Greatest Hits Collection

  • censoredDCXprestigedoc maxDCX-078DCX078118dcx00078
    • 2018-04-06
    239 min

    [GNE-200]What's Inside This Uniform Brand Called J？ 4

  • censoredschoolgirlGNEgallopneo giftGNE-200GNE200h-479gne00200
    • 2018-03-25
    479 min

    [KTKY-024]Spring Barely Legal Delinquents on Parade: The Breakaway Stars (20 People, 8 Hours)

  • censoredKTKYkittyx delusion tribeKTKY-024KTKY024ktky00024
    • 2018-03-23
    242 min

    [OKAX-357]Girl in Uniform Fucked!!

  • censoredcreampieschoolgirlOKAXkm produceside dishesOKAX-357OKAX35784okax00357
    • 2018-01-14
    480 min

    [KTKY-018]A Pay-For-Play Fuck Fest 20 Girls/8 Hours

  • censoredcreampieschoolgirlKTKYkittyx delusion tribeKTKY-018KTKY018ktky00018
    • 2017-12-22
    241 min

    [MDTM-312]Schoolgirl Asking for an S&M Breaking In 4 Hours

  • kanae seta kawaon walnut censoredcreampieschoolgirlMDTMmedia stationspace planningMDTM-312MDTM31261mdtm00312
    • 2017-12-22
    241 min

    [MDTM-315]Today, Tomorrow, And The Day After Too... My Very Own Schoolgirl Idol Who Will Let Me Creampie Her Anytime 4 Hour BEST

  • yuna himekawa sakura miyuki censoredcreampieschoolgirlMDTMmedia stationsuginokispace planningMDTM-315MDTM31561mdtm00315
    • 2017-11-13
    249 min

    [OYC-147]Even Without Aphrodisiacs, This Ultra Sensual Girl Will Cum Like She's Been Dosed, And Now It's Time For Over 30 Cum Shots Of Ultra Orgasmic Sex!

  • censoredOYCdinner.companymachirudahhh groupOYC-147OYC147oyc00147
    • 2017-11-10
    239 min

    [HONB-040]My First Orgy With My Friend 4 Hours

  • censoredHONBmercuryfirst shibuya special attack headquartersHONB-040HONB040h-1133honb00040
    • 2017-11-04
    242 min

    [HUNTA-370]"I'm A Grownup Now, And I Can Have Sex Too, Did You Know That？" When My Parents Got Remarried, I Suddenly Ended Up With A Little Schoolgirl Sister-In-Law She Was Much Younger Than Me, And When I Treated Her Like A Child, She Go

  • censoredschoolgirlsisterHUNTAhunterkawajirihhh groupHUNTA-370HUNTA370hunta00370
    • 2017-10-27
    485 min

    [TRE-056]A Beautiful Young Girl in Uniform With Beautiful Tits Pay-For-Play BEST Beautiful Tits x Uniform Get Your Last Looks Right Here!!

  • censoredschoolgirlbeautiful girlTREprestigetreasureTRE-056TRE056118tre00056
    • 2017-09-08
    236 min

    [LOVE-392]Private First Star Academy The Sexy Consultation Room Erotic Instruction By A Sexual Harassment Teacher!! 10 Schoolgirl Babes Totally Exclusive Footage 4 Hours

  • censoredcreampieuniformLOVEfirst starshorinji kawasakiLOVE-392LOVE392h-491love00392
    • 2017-02-05
    241 min

    [HUNTA-259]"You Can Touch My Tits, But That's All" The Female Manager Of My Team Is Really Nice But Very Strict In My Innocence, I Joined The Team, But I Had A Hard Time Keeping Up The Kind And Gentle Female Manager Was Worried That I Was

  • censoredschoolgirlHUNTAhunterkawajirihhh groupHUNTA-259HUNTA259hunta00259
    • 2016-12-24
    275 min

    [POST-371]This Is The Story Of How A Gangster Fucked My Girlfriend Away From Me The NTR Series My Schoolgirl Girlfriend Caused An Accident With Her Bicycle And The Victim Was A Big Bad Gangster... 2 "Hey Little Lady, You Crashed Into Me And Now M

  • censoredcreampieschoolgirlPOSTredpost redPOST-371POST371post00371
    • 2016-12-22
    485 min

    [NHDTA-923]Natural High End-of-Year Special Reunion with the Creampie Molester: All Videos in a Huge 8-hour Compilation!

  • censoredcreampiesquirtingNHDTAnatural highjacken kodamaNHDTA-923NHDTA9231nhdta00923
    • 2016-12-02
    244 min

    [YRH-137]Would You Please Try On That Uniform That's Lying Unworn In Your House？ 1

  • censoredsquirtingamateurYRHprestigesimicyyorozu honpoYRH-137YRH137118yrh00137
    • 2016-08-18
    240 min

    [STAR-703]Mana Sakura Beautiful Schoolgirl & Perverted Middle Aged Beast Have Sex

  • mana sakura censoredschoolgirlSTARsod creategoemonsod starSTAR-703STAR7031star00703
    • 2016-06-09
    394 min

    [SW-413]My Classmate's Skirt Is So Short I Can't Help But Eyeball Her Day In And Day Out. I'm Always Watching, And Her Panty Shots Are The Ultimate Temptation. When I Finally Confessed To Liking Her She Just Squatted On The Ground Right T

  • censoredSWswitchlight fujimaswitch switchSW-413SW4131sw00413
    • 2015-10-08
    241 min

    [IENE-612]Schoolgirls, How Would You Like To Experience Intercrural Sex With Your Dad Over A Single Sheet Of Plastic Wrap？

  • censoredschoolgirlIENEi energybambino puddingie nergyIENE-612IENE6121iene00612
    • 2015-06-10
    243 min

    [ULT-057]Schoolgirls Skipping Class! ~But Can They Stroll Around Town With A Remote-Controlled Vibrator In Their Pussy？~

  • censoredschoolgirlamateurULTprestigeultraULT-057ULT057118ult00057
    • 2015-06-06
    240 min

    [NHDTA-680]Don't Make A Sound 15

  • censoredschoolgirlNHDTAnatural highitaka smithlin powderNHDTA-680NHDTA6801nhdta00680
    • 2015-05-21
    244 min

    [HUNTA-006]De-Virginize Us! Cherry Boys' Five Days' War! We Are Close Virgin Buddies. We Have Got To Lose Our Virginity Somehow Before Graduation. So Using Our Good-Looking Friend's Help, We Developed An Operation Called [Cherry Popping P

  • censoredHUNTAhuntermorikihhh groupHUNTA-006HUNTA0061hunta00006
    • 2014-06-27
    242 min

    [ULT-016]We Buy Schoolgirl Panties!! On Top of Taking Them Off, They Even Did Stuff Like This!

  • censoredbig titsschoolgirlULTprestigeultraULT-016ULT016118ult00016
    • 2007-12-11
    54 min

    [DNW-006]After She Puts On Her Uniform

  • censoredschoolgirlbeautiful girlDNWnaniwa bookstoredragonDNW-006DNW006428dnw00006



    • Jav Cherry, watch JAV streaming online japanese xxx