sato kato




FC2PPPDNATRJULATIDROYDCHRVMILKSPRDDASDAUKSMARASQTEFSDSSWAAADASDHMNMEYDMIDEKBIVENU

2020-11-20
138 min

[GYAN-009]Big Tits Slut From Akihabara Maid Yuri Dreams Of Exposing Her Droopy Tits Everyday And Pants While Asking "Give Me Your Semen Milk" To Wet Her Pussy All Year Round, Then We Have Outdoor Sex As She Plays With My Cock Have A Look At T

  • censoredbig titsGYANprestigehimu lockgyan prestigeGYAN-009GYAN009118gyan00009
    • 2020-11-27
    47 min

    FC2PPV 1573496 Sarah’s finest Men’s technique ❤️ Reproduce the men’s back options of the part-time job era (such things and such things) ❤️ If you want to receive Sara’s Men’s statement, we will recruit on Twitter ❤️ Purchase

  • amateur uncensoredfc2
    • 2020-11-27
    80 min

    [HYPN-031]大好きなデリヘル嬢を臭いチ○ポにもしゃぶりつく専用性奴●にしてみませんか？古川いおり

  • iori furukawa censoredHYPNsod createsatoshi morikawamind controlHYPN-031HYPN0311hypn00031
    • 2020-11-27
    165 min

    [PAKO-028]Married Woman With K*ds Swaps Sexy Videos With Another Guy So He'll Pay Down Her Debt. The Day She Stops Sending Them Is The Day He Sells Them As Porn. Unfaithful Wife Takes A Secret Creampie.

  • censoredamateurmature womanPAKOmercuryold lady fucking cafeteriaPAKO-028PAKO028h-1133pako00028
    • 2020-12-01
    56 min

    FC2PPV 1579901 [Limited quantity 2980pt → 1980pt] Trajectory to M woman ❤️ Fainting convulsions with a thick vibe that insulted an active beautiful girl JD who is too beautiful with a ball gag ❤️

  • amateur uncensoredfc2
    • 2020-12-10
    125 min

    [GS-366]My Alluring Cousin Is So Erotic She's Got Me Rock Hard All The Time! I Came Up From The Country To Stay At My Relatives' Place In The City, And When I Met My Cousin For The First Time In Years, She Was So Sexy That I Got A Rampaging H

  • censoredcosplayGSsosoru x garconspada ikebukuroGS-366GS366h-101gs00366
    • 2020-12-25
    59 min

    [WKD-037]Fallen Woman June Lovejoy

  • june lovejoy censoredslutsingle workWKDwaap entertainmentk westwWKD-037WKD0372wkd00037
    • 2020-12-25
    47 min

    [DHT-225]A More-Than-20-Years-Age Gap May-December Romance Set Up On A Hookup App Seducing Girls Who Love Withered Old Men Chikako 20 Years Old

  • censoredamateurbeautiful girlDHThot entertainmententhusiastDHT-225DHT22559dht00225
    • 2020-12-27
    254 min

    [GAID-013]Fairy Tale BEST

  • ichika matsumoto nene tanaka censoredbig titsbeautiful girlGAIDfirst starbirdman teppeiaida first starGAID-013GAID013h-491gaid00013
    • 2021-01-02
    78 min

    [opcyn-140]ゆりあ 3(28)

  • amateur censoredbig titsamateuropcynopcyn-140opcyn140opcyn-140
    • 2021-01-04
    61 min

    1Pondo 010421_001 Model Collection: Ciel Hiiragi

  • amateur uncensored1pondo
    • 2021-01-05
    120 min

    [TUE-108]Barely Legal: Young Hottie Loves Anal Footage Collection

  • censoredanalcreampieTUEglay zteitora eizoTUE-108TUE10812tue00108
    • 2021-01-10
    88 min

    [VEC-460]Drenched In Sweat And Lust! Made To Give A MILF Escaped From Prison My Creampie Chisato Shoda

  • shota chisato censoredcreampiebig titsVECvenussarumegami venusVEC-460VEC460vec00460
    • 2021-01-24
    59 min

    200GANA-2424 In the spear room of the Nampa master of 100 battles, bring in SEX hidden shooting 189 Succeeded in bringing a model-class beauty who attracts attention from the surroundings to the spear room just by drinking alcohol! Sensitive Oma who

  • amateur censoredbig titsamateurganagana-2424gana2424200gana-2424
    • 2021-01-25
    83 min

    [THNIB-068]The White Paper Of A Pure Younger Sister - Teen Glitter - Tomoka Hayasaki

  • censoredbig titsbeautiful girlTHNIBintec incTHNIB-068THNIB068h-706thnib00068
    • 2021-02-01
    122 min

    [AMBI-118]Oh No! My Home Room Teacher Found My Cam Work! Hana Himesaki

  • himesaki hana censoredcreampiebig titsAMBIplanet plusdirector oanbibaresotsuAMBI-118AMBI118h-237ambi00118
    • 2021-02-05
    189 min

    [PLY-002]I'm So Embarrassed! A Reluctant Car Sex Documentary Himari Kinoshita/Nana Yaotome

  • nana yaotome himari kinoshita himari hanazawa censoredPLYplay entertainmentkaji shun wareplayPLY-002PLY002h-1557ply00002
    • 2021-02-13
    51 min

    FC2PPV 1684042 [Uncensored / Individual shooting] Inserted raw into a slender beauty with small breasts I met on SNS, thrust at the back

  • amateur uncensoredfc2
    • 2021-02-18
    121 min

    [TOEN-038]As Soon As Her Husband Steps Out, This Slutty Stepmom Is Riding Her Stepson's Cock - 10 Creampie Loads A Day... Nanako Seto

  • nanako seto censoredcreampiemarried womanTOENcenter villageyoichi sanotaoyuanTOEN-038TOEN038h-086toen00038
    • 2021-02-19
    37 min

    FC2PPV 1693403 Weekend only [Individual shooting] Prefectural general course ② Curious black-haired girl. She is Gonzo by a cram school teacher.

  • amateur uncensoredfc2
    • 2021-02-19
    124 min

    [MOPG-068]I'd Love It If That Slut Teased My Nipples While She Choked Me. Ayaka Muto

  • ayaka muto censoredhandjobnurseMOPGm man paradisemo goldMOPG-068MOPG068mopg00068
    • 2021-02-27
    143 min

    [JKSR-482]10 A.M.: Shouldn't You Be At School, Urara？ Urara Kaon

  • hanaoto urara censoredcreampieschoolgirlJKSRbig morkalobockeyprink junkyJKSR-482JKSR48257jksr00482
    • 2021-03-04
    76 min

    [REBD-540]Rio: Super Cute And A Quick Change - Rio Kuriyama

  • rio kuriyama censoredsingle workREBDrebeccahaka kureREBD-540REBD540h-346rebd00540
    • 2021-03-04
    70 min

    [KBTV-070]A Married Woman Shows A Side Of Herself That Her Husband Never Gets To See Kumi-san

  • censoredcreampiebig titsKBTVfirst av appearanceKBTV-070KBTV070h-244kbtv00070
    • 2021-03-12
    66 min

    328HMDN-344 [Abdominal muscle slender] Gonzo outflow of active medical college student Immediately withdrawal from school Affair sex with a married man who burns passionately

  • amateur censoredamateurbeautiful girlhmdnhmdn-344hmdn344328hmdn-344
    • 2021-03-26
    230 min

    [DNW-114]Hooking Up In Seconds Flat!! Sudden Sex!! Instant Fucking & Instant Orgasms 4

  • censoredcreampiebig titsDNWprestigedocument nowDNW-114DNW114118dnw00114
    • 2021-04-01
    36 min

    FC2PPV 1750481 [Personal shooting] ♀206 Female college student Me ◯ -chan 19 years old 7th time Pregnancy AV shooting training started for the second time without being disappointed in the fall ◯! (LOL)

  • amateur uncensoredfc2
    • 2021-04-17
    120 min

    [JUL-554]This Sweat-Drenched, Voluptuous Married Woman Ground Her Hips So Hard I Couldn't Move While I Gave Her My Creampie. Momoko Isshiki

  • momoko isshiki censoredmature womanslutJULmadonnasatsugu koyamaJUL-554JUL554jul00554
    • 2021-04-23
    53 min

    [WFR-015]Sharing A Room With My Awful Boss - Her Delicate Body Manhandled While She's Ravished Runa Tsukino

  • tsukino luna censoredsquirtingdeepthroatWFRwaap entertainmenttonkatsuwWFR-015WFR0152wfr00015
    • 2021-05-05
    240 min

    [BUR-570]A Woman At Rest Is The Perfect Prey! Witness The Fear Of Being Invaded By Evil Hands That Sneak In Under The Cover Of Darkness! A Real Document Featuring Forbidden Night Visit Creampie Sex In Leaked Pictures 4 Hours

  • censoredcreampiebeautiful girlBURgraysburstBUR-570BUR57012bur00570
    • 2021-05-08
    123 min

    [NASH-506]The Bride's Mother - 50-Something Mother-In-Law's Immoral Fucks

  • censoredcreampiemature womanNASHnadeshikoNASH-506NASH506nash00506
    • 2021-05-18
    133 min

    [SDAB-178]Ultra Perky H-Cup - Her Tits Don't Deflate Even When She's Lying Down - I Told You I Didn't Want My Box Licked, Didn't I？ Riho Takahashi Age 19 SOD-Exclusive Porn Debut

  • riho takahashi censoredbig titsschoolgirlSDABsod createusa pyonone s youthSDAB-178SDAB1781sdab00178
    • 2021-05-29
    41 min

    FC2PPV 1742511 Mosaic collapse version ❤️ Hostess Anna and active JD Yuka ❤️ First co-starring work with purchase privilege

  • amateur uncensoredfc2
    • 2021-06-12
    103 min

    [NSPS-998]Mature Moms 11 - A Stepson Taking The Place Of His Stepfather - Shuri Yamaguchi

  • yuri yamaguchi censoredmature womanmomNSPSnagae stylenagaeNSPS-998NSPS998nsps00998
    • 2021-06-15
    123 min

    [KUSE-018]A Real-Life Muscle-Bound Beautiful Girl You*uber Is Getting Her First Raw Creampie! She Got Into Powerful Position To Receive Real Sperm Injected Deep Into Her Pussy!! Yota Chan

  • chanyota censoredcreampiesingle workKUSEsod createzampathis actress style is amazingKUSE-018KUSE0181kuse00018
    • 2021-06-19
    240 min

    [CJOB-089]Best Of Full Cleaning Blowjobs Where The Girls Keep On Sucking Even After You've Cum Over And Over

  • ichika matsumoto satoshi kuruki censoreduniformblowjobCJOBslut havenslut haven bestCJOB-089CJOB089cjob00089
    • 2021-06-29
    47 min

    FC2PPV 1893598 ♪♪ Excavation ♪♪ Mai-chan 25 years old Super cute fair-skinned H-cup large amount of breast milk mom and breast milk play-in-mouth firing ※※ with benefits ※※

  • amateur uncensoredfc2
    • 2021-07-01
    106 min

    413INST-135 [Amateur / Concafe Clerk] Leaked Gonzo Holiday Layer Private Photo Session Massive Creampie In A 20-year-old Beautiful Girl Pussy

  • amateur censoredcreampiebig titsinstinst-135inst135413inst-135
    • 2021-07-15
    127 min

    [GTJ-094]Anal Fuck Sayuki Mogami

  • sayuki mogami censoredanalbdsmGTJdogmatohjirogold tohjiro levelGTJ-094GTJ094gtj00094
    • 2021-07-16
    55 min

    FC2PPV 1926027 [Appearance] Dated With A 140 Cm Active Concafe Lady. Her Uncle Plays With Her Little Body And Cums Continuously

  • amateur uncensoredfc2
    • 2021-07-24
    63 min

    HEYZO 2569 Foursome Fantasy With A Plump Girl! Vol.2 – Mao Umino

  • mao umino uncensoredcreampiehandjobheyzo
    • 2021-09-03
    155 min

    [MIAA-490]If You Don"t Want Your Husband Fired Then Be Face Fucked By His Boss Natsuki Takeuchi

  • natsuki takeuchi censoreddeepthroatsingle workMIAAmoodyzakai suiseiminna no kikatanMIAA-490MIAA490miaa00490
    • 2021-09-09
    129 min

    [MEKO-214]"The Old Lady Rental" Service Returns 03 If You Ask This Sexy And Kind Old Lady, She"ll Secretly Let You Have Creampie Sex, And I Seriously Wanted To Fuck Her Again Like Crazy, So I Asked For Second Helpings

  • censoredcreampieamateurMEKOmature woman laboMEKO-214MEKO214h-1160meko00214
    • 2021-09-10
    119 min

    [JUL-702]It"s Been A Year And A Half Since Her Debut ... The Long-Awaited Lifting Of Her Creampie Ban!! After Every Time She Has Babymaking Sex With Her Husband, She"s Been Continuously Creampie Fucked By Her Father-In-Law ... Rena Kodama

  • kodama rena censoredcreampiebig titsJULmadonnarokusaburo mishimaJUL-702JUL702jul00702
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-18
    97 min

    500DPL-0036 Former Kindergarten Teacher CAR Sex Haru Shiina

  • amateur censoredamateurdpldpl-0036dpl0036500dpl-0036
    • 2021-09-24
    112 min

    [VENX-074]Fakecest With A Stepmother In A Bikini. That Unforgettable Summer Before the Coronavirus Was So Much Fun. Hana Himesaki

  • himesaki hana censoredcreampiebig titsVENXvenussaruincest vi nasuVENX-074VENX074venx00074
    • 2021-10-01
    124 min

    [AMBI-138]Papa"s A Pervert! And He Loves His Sex Toys A Beautiful Y********l In Uniform Had Her Relationship With Her Boyfriend Torn Apart Riko Shinohara

  • riko shinohara censoredcreampieuniformAMBIplanet plusdirector oanbibarentsuAMBI-138AMBI138h-237ambi00138
    • 2021-10-02
    57 min

    FC2PPV 2284918 [Uncensored] A Favorite Daughter Of A Regular Ramen Shop. Gonzo Only Once To Help Her * Weekend Limited Sale

  • amateur uncensoredfc2
    • 2021-10-30
    58 min

    H4610 ki211031 Eri Sagawa 30years old

  • amateur uncensoredh4610
    • 2021-11-05
    161 min

    [BBAN-347]Nipple Lesbian Series: What Happened To Me On My Singles" Travel To The Hot Springs - Mina Kitano Mao Hamasaki Yui Hatano

  • mina kitano hamazaki mao censoredlesbianBBANbibianBBAN-347BBAN347bban00347
    • 2021-11-19
    233 min

    [REXD-389]Composite Bogus Ghost Photography! I Tried Fucking a Female Self-Proclaimed Medium. "What is an Evil Spirit! I Made It. - Laugh Out Loud"

  • censoredcreampiebig titsREXDredmanji groupREXD-389REXD389rexd00389
    • 2021-11-20
    68 min

    200GANA-2595 Seriously Nampa, First Shot. 1717 Picking Up Fashionable Girls Shopping In Daikanyama! A Top Ball Like A Magazine Model! When You Reach For The Beautiful Legs And Hips, It Doesn’T Look Like It’S Full …？ Don’T Miss The

  • amateur censoredamateurganagana-2595gana2595200gana-2595
    • 2021-12-11
    121 min

    [MDS-898]Papa, Mama, And I Are Being Made To Feel Good By An Old Man Every Day In A Faraway Place. Yuzu Shirakawa

  • yuzu shirakawa censoredcreampiebeautiful girlMDSuchu kikakujohnny shibuyaMDS-898MDS898mds00898
    • 2021-12-14
    142 min

    1Pondo 121421_001 Special Edition Emi Sakurai Emi Sakurai

  • amateur uncensored1pondo
    • 2021-12-17
    121 min

    [KAM-097]I Brought The Married Woman Part-Timer Home From A Work Party, And Took Hidden Camera Voyeur Footage Of Our Fucks, Then Secretly Sold It As Porn 9

  • censoredcreampiebig titsKAMkarmamanji groupKAM-097KAM097kam00097



    • Jav Cherry, watch JAV streaming online japanese xxx