sailor suit sister delusion group jav big tits




FC2APODNGODAUKGPPPDGMEMIPXKBISDABHODVDASDSSISFSDSSDASDMVSDCAWDSQTESHKDDTTPREDAVSA

2020-12-25
46 min

[ETQR-185][Daydream POV] Fucked And Impregnated Girl AIMI - Aimi Otosaki

  • aimi otosaki censoredcreampieuniformETQRerotic timeETQR-185ETQR185h-1186etqr00185
    • 2020-12-31
    116 min

    [NKKD-189]Red-Hot Dripping And Sweaty NTR A Wife And A Young S*****t Adultery Sex In A Cramped Apartment Reiko Kobayakawa

  • kobayakawa reiko censoredbig titsmature womanNKKDjet eizomanji groupNKKD-189NKKD189nkkd00189
    • 2020-12-31
    100 min

    AVKH-190 Mashima Aya

  • amateur censoredamateuravkhavkh-190avkh190avkh-190
    • 2021-01-01
    156 min

    [HZ-005]Hey Babe, Your Body Should Be Illegal It Looks So Delicious Miu Arioka

  • arioka miu censoredcreampiebig titsHZplumposts asakusa is jiroamateur only plumHZ-005HZ005h-113hz00005
    • 2021-01-09
    56 min

    FC2PPV 1638693 [Individual shooting] Connected with the returnee child J system of foreigner half

  • amateur uncensoredfc2
    • 2021-01-10
    57 min

    FC2PPV 1639088 [Uncensored / No Mo] Buyer review benefits available (high-quality version) _ [It’s not bad to take it off] Chisato / 24 years old / OL [Complete appearance] Clothed raw squirrel cum shot SEX

  • amateur uncensoredfc2
    • 2021-01-15
    486 min

    [MTM-019]Street Corner Amateur Pick-Up! A Hot Housewife Gets Picked Up. Raw Creamie Best-Of 8 Hours vol. 01

  • censoredcreampieMTMprestigemegatra maxMTM-019MTM019118mtm00019
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-17
    119 min

    [SCD-189]Raw Creampie Into A 50-something Mom With Bit Tits - Aki Misato

  • aki misato censoredmature womansingle workSCDrubysuke kato 6scoopSCD-189SCD189scd00189
    • 2021-01-20
    53 min

    FC2PPV 1652623 Iki crazy woman] Nerima G cup busty wife 25 years old [20,000 yen a day, monitor recruitment] Wife who came to the adult toy test pretending to be serious. When she shows a big cock, she immediately falls. She has convulsions acme many

  • amateur uncensoredfc2
    • 2021-01-22
    46 min

    [oretd-839]NAGASE

  • amateur censoredcreampieuniformoretdoretd-839oretd839oretd-839
    • 2021-01-23
    243 min

    [GS-2004]True Stories: Family Fun [TheBEST] 2019.10-2020. 04

  • censoredGSgosGS-2004GS2004h-101gs02004
    • 2021-01-24
    131 min

    [CESD-973]Her First Lesbian Sex - Voluptuous I-Cup Nao Kakuchi's Colossal Tits Corrupted By Yui Hatano 's Girl On Girl Orgasms!

  • nao kikuchi yui hatano censoredbig titslesbianCESDceleb no tomoCESD-973CESD973cesd00973
    • 2021-01-29
    32 min

    480FRIN-017 《Personal shooting / voyeur》 Affair sex video leaked between a certain storyteller’s G cup wife and a junior entertainer

  • amateur censoredbig titsmarried womanfrinfrin-017frin017480frin-017
    • 2021-02-07
    120 min

    [SNTJ-017]Former Rugby Player Takes Her to a Hotel, Films the Sex on Hidden Camera, and Sells it as Porn. vol. 17

  • censoredamateurbeautiful girlSNTJsojitsusha mousouzokuSNTJ-017SNTJ017sntj00017
    • 2021-02-08
    84 min

    FC2PPV 1661285 [Idol GET] Half beautiful girl idol, SEX Gonzo video before debut! A carnivorous girl who straddles her boyfriend and shakes her hips while licking her nipples! Exposing intensely dangerous copulation with boobs, mouth, pussy w [outflo

  • amateur uncensoredfc2
    • 2021-02-25
    65 min

    FC2PPV 1701078 [Complete amateur 101] Azusa 19 years old, complete appearance, vaginal cum shot from the beginning! A masochistic G-cup girl.

  • amateur uncensoredfc2
    • 2021-02-26
    92 min

    SNYZ-020 Aria-chan 2

  • amateur censoredamateurcosplaysnyzsnyz-020snyz020snyz-020
    • 2021-03-27
    239 min

    [MCSR-433]Slutty Cougars Widows Get Fucked In Front Of Portraits Of Their Dead Husbands 8 Women 4 Hours

  • censoredcreampiemature womanMCSRbig morkalguo masumascottMCSR-433MCSR43357mcsr00433
    • 2021-04-02
    81 min

    259LUXU-1416 Luxury TV 1386 Slender Tall Active Graduate Student and Model Beauty Appears For The First Time In AV! !! Instinctual sex that a high-level woman with a super SSS class face, body, and brain fascinates with her instinct!

  • amateur censoredamateurluxuluxu-1416luxu1416259luxu-1416
    • 2021-04-08
    64 min

    230OREC-730 Mizuki

  • amateur censoredcreampiebig titsorecorec-730orec730230orec-730
    • 2021-04-14
    119 min

    [TPPN-191]Her First Ever Ecstasy! Girl With Exotic Curves Goes Crazy For Incredible Orgasms - The Naughtiest, Nastiest Sex Of Her Life

  • censoredbig titsblowjobTPPNteppanTPPN-191TPPN191tppn00191
    • 2021-04-17
    120 min

    [HND-979]She'll Spread Her Legs The Second You Ask - College Girl (Age 20) Working Part-Time At A Convenience Store Cheats With Her Boss - Creampie Sex On Her Ovulation Day Hana Shirato

  • white peach censoredcreampiebeautiful girlHNDhon nakacontour styleHND-979HND979hnd00979
    • 2021-04-22
    61 min

    10musume 042221_01 Super Sensitive Girl Squirt a Lot Mako Ashida

  • amateur uncensored10musume
    • 2021-04-28
    40 min

    517MQXT-005 A Beautiful Girl Who Is Blame Until She Fades Her Secret With Bondage Wide Open Legs

  • amateur censoredamateurbeautiful girlmqxtmqxt-005mqxt005517mqxt-005
    • 2021-05-11
    83 min

    469G-643 Imadoki Girls’ Circle Exchange (Daddy Activity) Circumstances! Marina

  • amateur censoredcreampieuniformgg-643g643469g-643
    • 2021-05-21
    142 min

    [JUL-581]High Class Glamorous Beauty Makes Her Debut! Secret Meeting And Raw Sex To Get Pregnant My Husband's Friend Cums Over Every Month When I'm Ovulating... Mei Satsuki

  • satsuki mei censoredcreampiebig titsJULmadonnahimu lockJUL-581JUL581jul00581
    • 2021-06-04
    118 min

    [PRED-319]I Could Never Call You My Stepmom. My Dad Got Remarried To A Woman Who Was Too Young And Beautiful, So When We Went On A Family Vacation Together, I Spent The Next 3 Days And 2 Nights Secretly Creampie Fucking Her ... Yu Shinoda

  • shinoda yu censoredcreampiebig titsPREDpremiumdragon nishikawaelegancePRED-319PRED319pred00319
    • 2021-06-08
    136 min

    [SDNM-287]My Half-Japanese, American Wife's An Ex-Model, And Now She's The Neighborhood Bicycle - Shigemori Aya Age 30, Chapter 2 - Pleasure Makes Her Forget All About Her Husband - Wild Orgasmic FUCKS

  • shigemori aya censoredmature womansingle workSDNMsod createakira saijogenuine married woman the porn experienSDNM-287SDNM2871sdnm00287
    • 2021-06-12
    138 min

    [TPIN-005]His Wife Is Right Beside Him, But ... While Giving Her Husband A Massage, This Massage Parlor Therapist Secretly Slipped His Cock Into Her Pussy And Hid The Deed Underneath Her Skirt And Creampie Fucked Him, And He Could Nothing But Go With

  • censoredcreampieTPINchinpoinTPIN-005TPIN005tpin00005
    • 2021-06-13
    35 min

    FC2PPV 1866531 Limited number [Individual shooting] Prefectural ordinary course ② Twinte girl ・ From the promise of photography only, staying Gonzo

  • amateur uncensoredfc2
    • 2021-06-17
    14 min

    FC2PPV 1873287 For a limited time [Individual shooting] Prefectural General Course ③ A girl who is sexually perverted by inserting raw into a burning body after a massage at a cheer club / hot spring hotel.

  • amateur uncensoredfc2
    • 2021-06-26
    160 min

    [LULU-079]This Beautiful Wedding Planner Gave The Groom A Deep Throat 3D Blowjob That He Could Never Get From His Wife, And Showed Off Her Amazing Technique In A Display Of Her Powerful Cum Swallowing Semen-Sucking SK**ls Yumi Saeki

  • yuka saeki censoredcreampiesingle workLULUlunaticsvagmanLULU-079LULU079lulu00079
    • 2021-07-15
    95 min

    [AKDL-126]"Don't Put It In!" You Promised...Inserting It Raw Into The Moist Vagina Between Her Things I Fuck My Best Friend's Adorable Girlfriend Rua Takashiki

  • takashiki censoredcreampiedramaAKDLaquinoriaquinoriaknrAKDL-126AKDL1261akdl00126
    • 2021-07-16
    55 min

    Caribbeancom 071621-001 The most important duty of nurse is helping patients ejaculate Yui Kisaragi

  • yui kisaragi uncensoredhandjobbukkakecaribbeancom
    • 2021-08-20
    120 min

    [JUL-678]Big Exclusive "First" Real NTR Movie. "I Want To Pretend To Be Your Wife"s Lover..." The Worst Possible Outcome After I Lend My Beloved Wife To My Desperate Best Friend... An Komatsu

  • anzu komatsu censoredcreampiemature womanJULmadonnaorion zachouJUL-678JUL678jul00678
    • 2021-08-29
    49 min

    292MY-459 Sho Miyoshi 1

  • amateur censoredmarried womanamateurmymy-459my459292my-459
    • 2021-09-09
    159 min

    [SW-797]My Classmate First Love With Big Tits And My Female Teacher With A Big Ass Meet At The Class Reunion To Fuck! 10 Years Later She Is a Married Woman With A Curvy Ass And Tits, Now I"m Too Hard And She"s Working My Dick At The Store, Ho

  • censoredbig titsSWswitchyocchanswitch hibinoSW-797SW7971sw00797
    • 2021-09-25
    137 min

    [CEAD-363]Chisato Shoda Mature Woman With Glasses Gets Super Horny. Mature Woman With Glasses On Gets Lewd And Wild For Sex & Masturbation!

  • shota chisato censoredbig titsmature womanCEADserebu no tomoCEAD-363CEAD363cead00363
    • 2021-10-01
    145 min

    [JUNY-045]Her Tempting Ass Is So Big It Pokes Out Without Her Knowing! Huge Ass Teacher"s Anal Climax Life, Shiori Kimura

  • shiori kimura censoredcreampiebig titsJUNYfitchnikuyokuJUNY-045JUNY045juny00045
    • 2021-10-07
    125 min

    [NHDTB-588]At The Campsite With A Beautiful Legs Gal That Gets Super Wet And Ready To Fuck After Putting A Remote Vibrator In Her Hotpants.

  • censoredNHDTBnatural highkansukeNHDTB-588NHDTB5881nhdtb00588
    • 2021-10-11
    53 min

    541AKYB-013 Yuma (19) Medium ○ In An F Cup Black Hair Beautiful Girl With Little Experience ♪ (Mayumi Okino)

  • amateur censoredamateurbeautiful girlakybakyb-013akyb013541akyb-013
    • 2021-10-20
    124 min

    [GVH-307]Father In Law and Daughter In Law, Close Creampie and Sex. Sakura Tsuji.

  • sakura tsuji censoredcreampiegrandfatherGVHglory questtakahashi chitsujiGVH-307GVH307gvh00307
    • 2021-11-01
    72 min

    476MLA-056 Unauthorized Vaginal Cum Shot On A Business-Like Individual Shooting Layer! The Second Round Of Facial Cumshots! !! Sensitive Constitution That Is Weak To Push Is A Big Cum Of Ikuiku Continuous Call With A Demon Piston! !! (Himari Kinoshit

  • amateur censoredcreampieamateurmlamla-056mla056476mla-056
    • 2021-11-11
    135 min

    [STARS-466]一流競泳選手M性開発3本番 初体験だらけの濃密性交 青木桃

  • amateur censoredSTARSsodSTARS-466STARS466
    • 2021-11-25
    49 min

    H0930 ki211125 Takako Kuronuma 38years old

  • amateur uncensoredh0930
    • 2021-12-11
    67 min

    C0930 tk0048 Natsumi Kawauchi 28years old

  • amateur uncensoredc0930
    • 2021-12-24
    148 min

    [SSIS-269]Best Jcup Therapist "Anzai Lara" Serves Men"s Esthe

  • anzai rara censoredbig titssingle workSSISs1 no 1 stylegoemonSSIS-269SSIS269ssis00269
    • 2021-12-31
    120 min

    [WAAA-131]Anytime, Anywhere Blow Job Lascivious Date If You Can Stand It, You Will Be Able To Gobble Up All Of Them With Your Upper And Lower Lips.

  • bud censoredcreampieblowjobWAAAwanz factorywanzWAAA-131WAAA131waaa00131
    • 2022-01-08
    78 min

    200GANA-2610 Seriously Nampa, First Shot. 1740 "If You Drink Alcohol, You Might Want To Have Sex ♪" Bring An H-Cup Girl Who Is Too Erotic To The Hotel And Take A Gonzo! Boobs That Sway Swaying … Sensitivity Is Also A First-Class Item! !!

  • amateur censoredbig titssquirtingganagana-2610gana2610200gana-2610
    • 2022-01-30
    242 min

    [RD-1098]Mature Woman Sex Drama Complete Collection. Athena Sex Museum, 10 Performers, 4 Hours. Older Women Go Crazy While Getting Taking Advantage Of Right In The Middle Of The Day.

  • amateur censoredblowjobmature womanRDatena eizouRD-1098RD1098
    • 2022-02-01
    46 min

    C0930 ki220201 Eriko Ikegami 24years old

  • amateur uncensoredc0930
    • 2022-02-05
    135 min

    [NSFS-064]The Working Wife Is Fucked On A Business Trip, No. 2. Natsu Tojo

  • natsu tojo censoredsingle workdramaNSFSnagae stylejotaro tomiNSFS-064NSFS064nsfs00064
    • 2022-02-05
    132 min

    [URKK-054]Minimum Of 10 Shots! Huge Tit Aphrodisiac Salon With Unlimited Cream Pies As They Shake Tits. Alice Kisaki

  • kisaki alice censoredcreampiebig titsURKKunfinishedwild sevena familiar breastURKK-054URKK054urkk00054
    • 2022-02-19
    240 min

    [REAL-790]Extremities - S&M SEX That Induces An Orgasm As The Straw Rope Bites Into Her Skin. 4 Hours Of The BEST In Extremities.

  • roaring sound miku abe censoredbdsmREALreal worksk taroreal real worksREAL-790REAL790real00790
    • 2022-02-25
    129 min

    [UFD-070]Sex With A Lustful Stewardess. Kanna Uno

  • uno sakina abe sakina censoredsingle workUFDdream ticketUFD-070UFD07024ufd00070



    • Jav Cherry, watch JAV streaming online japanese xxx