ruka




FC2GMEMCJODBBANATIDLULUMVSDMEYDHZGDSSNICESDMARAPPPDAWDMILKSQTEWAAANACREBODPREDDASD

2020-12-12
139 min

[JUFE-232]Rena's Eyes Never Leave You With This Exclusively POV Footage! My Stepsister's In Love With Me And We Fuck Everywhere In The House - Sweaty Sex And The Absolute Temptation Of Her Colossal TIts! Rena Momozono

  • reina taoyuan censoredbig titssisterJUFEfitchJUFE-232JUFE232jufe00232
    • 2020-12-13
    139 min

    [MIBM-005]Plump Asses And Swimsuit Competition - Ami Kashiwagi

  • ami kashiwagi censoredMIBMmillmil silverMIBM-005MIBM005mibm00005
    • 2021-01-06
    67 min

    [sika-008]のぞみ＆めぐ

  • amateur censoredcreampieschoolgirlsikasika-008sika008sika-008
    • 2021-01-28
    244 min

    [IQQQX-002]Needing To Be Quiet Gets Her Ten Times Wetter - Married Teacher Nailed In The Classroom Deluxe Edition 2 10 Girls, 4 Hours

  • censoredcreampiemature womanIQQQXcenter villagezora center villageIQQQX-002IQQQX002h-086iqqqx00002
    • 2021-01-30
    149 min

    [MIAA-380]Busty Wife Gets Fucked By Her Husband`s Hated Boss All Over Again Hikari Sena

  • hikari sena censoredcreampiesingle workMIAAmoodyzzaku araieveryone s porn starMIAA-380MIAA380miaa00380
    • 2021-01-31
    135 min

    [NKD-269]Koichi Takahashi's Adulterous Secret Meeting With A Married Woman 3

  • censoredamateurmature womanNKDnakajima kogyokoichi takahashiNKD-269NKD269nkd00269
    • 2021-02-04
    132 min

    1Pondo 020421_001 Mikuro Komori: Mikuro Komori Special Edition

  • amateur uncensored1pondo
    • 2021-02-05
    92 min

    [SS-014]All For You - Ibuki Aoi

  • censoredcreampieamateurSSplumSS-014SS014h-113ss00014
    • 2021-02-05
    92 min

    [SS-015]My Girl - Urara Kanon

  • censoredcreampieschoolgirlSSplumSS-015SS015h-113ss00015
    • 2021-02-12
    117 min

    [YAKO-023]Skinny Girl

  • censoredamateurbeautiful girlYAKOmercuryshinjuku undergroundYAKO-023YAKO023h-1133yako00023
    • 2021-02-13
    38 min

    FC2PPV 1684210 [Hidden shooting from the warehouse] Defeat Miss Big Breasts Menes with a glasses-type camera ❤️ Limited quantity

  • amateur uncensoredfc2
    • 2021-02-14
    59 min

    FC2PPV 1686390 [Unprecedented 6P outflow! ] Big areola for big breasts and beautiful breasts! Bitch 3 beauty vs big cock corps creampie! Squirting! Continuous Acme Shuike Meat Forest Hyper Raw Saddle Orgy [Personal Shooting]

  • amateur uncensoredfc2
    • 2021-02-17
    13 min

    S-Cute 817_mone_02 I took a picture of her blowjob in the bathroom / Mone

  • mone censoredamateurmonemone-02mone02817-mone-02
    • 2021-02-26
    64 min

    [MASE-014]Horny Older Woman 32 Year Old Nozomi Has Her Plump White Body Filled With Cum As She's Fucked Standing From Behind Twice! Nozomi Haneda

  • nozomi haneda censoredcreampiebig titsMASEcrystal picturemadam maniac plusMASE-014MASE01449mase00014
    • 2021-03-01
    80 min

    [HKHS-011]LUCKY YOU Your Destiny Nora Hollywood Girl Made Into A Sex Servant By Japanese Tourists

  • censoredcreampiemarried womanHKHShikara delusion groupsamuraiHKHS-011HKHS011hkhs00011
    • 2021-03-02
    126 min

    [ARM-956]She'll Get You Mad Horny With Her Youth And Cheerfulness But Letting You Cum Is Against The Rules

  • censoredARMaroma planningshigeo kadowakiaromaARM-956ARM956arm00956
    • 2021-03-13
    121 min

    [DASD-827]It Looks Like You Can Fuck Them, But You Can`t. Famous Snack Bar In An Area Famous For Beautiful Hostesses. Hijiri Maihara

  • kiyoshi maihara censoredcreampieblowjobDASDdaskirinDASD-827DASD827dasd00827
    • 2021-03-19
    128 min

    [MKON-048]My Girlfriend Found Out About My NTR Hangup, And So, On My Birthday, Perhaps Thinking That I Liked That Kind Of Thing, She Showed Me A Video Of Her Getting Creampie Fucked By Some Strange Old Man Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiesingle workMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-048MKON048mkon00048
    • 2021-03-24
    116 min

    240TOKYO-422 Mitsuha

  • amateur censoredamateurbeautiful girltokyotokyo-422tokyo422240tokyo-422
    • 2021-04-13
    50 min

    FC2PPV 1768376 * Limited time 2980⇒1980pt ★ Amateur wife ☆ Pocha Lori busty wife Marimo-chan re-advents without worrying even if her 23-year-old gets caught by her husband! ☆ Perverted young wife who came to a 3P orgy with sexual desire ♥ Lust for tw

  • amateur uncensoredfc2
    • 2021-04-17
    118 min

    [NNPJ-442]4 Raw Creampie Loads - Titty Fuck And Blowjob-Loving Nurse, Age 25 - She Just Came Off The Night Shift, But She's Trolling For Cock On A Hook-Up App - Sexy Nurse Wants Creampie Sex At A Love Hotel - Real-Life Nurse Ms Mikako

  • censoredcreampieblowjobNNPJnanpa japanNNPJ-442NNPJ442nnpj00442
    • 2021-04-17
    193 min

    [JUL-545]Surprise Transfer Madonna Exclusive Kana Yume Hot And Steamy Adult Kisses Dripping With Spit 3 Video Special

  • kana yui censoredmature womansingle workJULmadonnamametaro mamezawaJUL-545JUL545jul00545
    • 2021-04-22
    32 min

    FC2PPV 1782452 Limited number [Individual shooting] Prefectural general course ② 170 cm beautiful leg girl. Gonzo before the part-time payday. Looks strong and hurts and panting

  • amateur uncensoredfc2
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-04-30
    74 min

    300NTK-561 Urgent insertion delivery! !! The bright erotic squirrel of a natural beautiful girl loved by God explodes! !! I tried to play with a happy bitch toy ♪ has started safely! !! It shouldn’t end with just a toy, and continuous ascension

  • amateur censoredcreampieamateurntkntk-561ntk561300ntk-561
    • 2021-06-16
    238 min

    [PPBD-212]Big Bouncing Titties In My Hands! They're All Mine! Titty Harem Heaven BEST

  • tsujii honoka nene tanaka censoredcreampiebig titsPPBDoppaiPPBD-212PPBD212ppbd00212
    • 2021-06-17
    151 min

    [SOAN-060]Passionate Asshole Punch Fucker Identity Hidden By Full Face Mask! Wife Number 27 Shows Off Her Asshole

  • censoredamateurSOANyama to soramaketaro tanizokoanal visitSOAN-060SOAN060soan00060
    • 2021-06-18
    73 min

    [SS-026]Lovin' You Yu Shinoda

  • ai uehara yoshinaga akane censoredcreampiebig titsSSplumSS-026SS02613ss00026
    • 2021-06-25
    117 min

    [MIMK-090]K**ling Time With My Niece - Live Action - Nana Yagi

  • nana yagi censoredsquirtingbeautiful girlMIMKmoodyzdragon nishikawamankitsuMIMK-090MIMK090mimk00090
    • 2021-07-09
    55 min

    FC2PPV 1882737 [Personal shooting] Meguru 23 years old Massive launch to a super cute miracle dirty beauty in agony

  • amateur uncensoredfc2
    • 2021-07-18
    243 min

    [NANX-232]A Pretty & Horny Woman Picks Up Innocent-Looking Amateur Girl On The Street For Some Lesbian Action 3

  • nozomi haneda ayako inoue censoredlesbianNANXnanpa heavenjun nagasawaNANX-232NANX232nanx00232
    • 2021-07-18
    238 min

    [OKAX-760]She opens up to show me her soaked panties, Wet sounds with a finger! The gaze titillates! Girls who become horny by being watched

  • mizuki mai hoshino leia censoredslutOKAXk m produceokazuOKAX-760OKAX760okax00760
    • 2021-08-07
    127 min

    [USAG-035]Maki-chan (20) Dark-Gal /Big Tits/ Huge Ass/ Piling Cowgirl/ Facial / Creampie/ 3 Real Sex/ 3P

  • censoredbig titsUSAGusagi mousozokuUSAG-035USAG035usag00035
    • 2021-08-10
    98 min

    FC2PPV 1979403 It Was Ridiculous! Wait For A While. Immediately Delete Your Body! [No Individual Shooting, Darkness Route No. 6. Honor Student Lady, Outflow] The Darkness Of A Beautiful Girl With A Loli Face … The Settlement That Can Not Be Said

  • amateur uncensoredfc2
    • 2021-09-14
    68 min

    499NDH-028 [Urgent Coverage] Affair Creampie Sex In Exchange For Rewards! Married Woman Immerse In The Host Club Without Telling Her Husband [Translation Ali Debt Wife Case 4]

  • amateur censoredcreampiebig titsndhndh-028ndh028499ndh-028
    • 2021-10-15
    95 min

    [VENX-084]Mistakenly Inserted In My Mother-In-Law, Mistaking My Mother-In-Law and My Wife"s Ass. Kimishima Mio

  • kimishima mio censoredcreampiebig titsVENXvenuskitano majimeincest vi nasuVENX-084VENX084venx00084
    • 2021-10-16
    123 min

    [ZOCM-009]She Was My Honor S*****t ... And She Hit Me With Reverse NTR. A Brilliant Girl With A Standard Deviation Score Of Over 70 Mao-chan Mao Watanabe

  • mao watanabe censoredcreampieuniformZOCMzokuzoku musume mousouzokutodozokuzoku musumeZOCM-009ZOCM009zocm00009
    • 2021-10-26
    60 min

    FC2PPV 2371647 [No] [Complete Appearance] 20-Year-Old Faculty Of Literature Neat And Clean Beautiful Girl Yuki-Chan ＃ 4 "It’S Okay To Have A Baby .. !!" 12)

  • amateur uncensoredfc2
    • 2021-10-28
    143 min

    [SPRD-1476]To My Surprise ... I Discovered That My Father Got Remarried ... To My Former Teacher ... Chisato Shoda

  • shota chisato censoredmature womansingle workSPRDtakara eizoumimasaka shunaleddinSPRD-1476SPRD147618sprd01476
    • 2021-10-30
    130 min

    [KTKL-100]Ebisu Promotion. Neru/Colossal Tits, I-Cup

  • censoredbig titsamateurKTKLkichikkusu mousou zokuroriKTKL-100KTKL100ktkl00100
    • 2021-11-13
    70 min

    355OPCYN-197 Urara (Kanon Urara)

  • amateur censoredcreampieamateuropcynopcyn-197opcyn197355opcyn-197
    • 2021-11-14
    82 min

    200GANA-2613 [Shibuya Halloween 2021] Successful Pick-Up Of A Duo Cosplay Beauty! The Erotic Nurse Who Gets Caught Up In The Huge Breasts Of The H Cup Is A Spear Who Wants To Be Spoiled … The Appearance Of Disturbing The Boobs And Spree Is Too H

  • amateur censoredbig titssquirtingganagana-2613gana2613200gana-2613
    • 2021-11-19
    38 min

    480FRIN-059 [45-Year-Old Shimbashi Store] Hidden Camera Of A Popular Mature Masseuse Without Rubber Sex Video

  • amateur censoredcreampiemarried womanfrinfrin-059frin059480frin-059
    • 2021-11-22
    66 min

    OREX-320 Sarina-San 4 (Sarina Momonaga)

  • amateur censoredcreampiebig titsorexorex-320orex320orex-320
    • 2021-11-26
    42 min

    FC2PPV 2466653 "No, Raw Vaginal Cum Shot" Reappears! Kaya-San, An Intelligentsia Returnee ❤ Licking Nipples, Rods, Back Muscles, Balls, And Anal With Plenty Of Fun! Show Off Masturbation And Squeeze Raw Semen At The Woman On Top Posture! !! !

  • amateur uncensoredfc2
    • 2021-11-27
    300 min

    [JKSR-520]Girl Hunting God BEST!! Big Tits Ratio Over 80!! Married Women Stimulate Men"s Hunting Instinct. 10 People. 5 Hours.

  • censoredmarried womanamateurJKSRbig mocalobockeypink junkieJKSR-520JKSR52057jksr00520
    • 2021-11-27
    119 min

    [SNKH-015]文系美少女だって黒人さんとヤリたい！内気で大人しい女の子が黒マラで潮吹きアクメ 日泉舞香

  • maika hizumi censoredsquirtingbeautiful girlSNKHsharksnarkhoodSNKH-015SNKH015h-687snkh00015
    • 2021-12-07
    50 min

    1Pondo 120721_001 Hospitality: Specialist to ejaculate Utaha Tsukishiro Jessica Takizawa Amu Mashiro

  • amateur uncensored1pondo
    • 2021-12-14
    52 min

    229SCUTE-1158 Minon (21) S-Cute I’m Ashamed To Caress Myself (Aisu Minon)

  • amateur censoredsquirtingamateurscutescute-1158scute1158229scute-1158
    • 2021-12-17
    142 min

    [DVDMS-749]Quickie Pounding For Janitor MILFs With Irresistibly Tight Asses Dispatched To The One-Way Mirror Cab! "You Didn"t Tell Me They"d Be Filming It..." They Protest, But The Director"s Huge Dick Overwhelms Their Sense Of Ca

  • censoredamateurDVDMSdeep sswing nagaseDVDMS-749DVDMS749dvdms00749
    • 2021-12-24
    119 min

    [ROE-034]MONROE Exclusive. Educated Elite Wife Round 2!! Had Creampie Sex With Wife of Boss Who I Had A Crush On For 10 Years Before We Parted. Suzuka Kisaki

  • kisaki suzuka censoredcreampiemature womanROEmadonnaunicorn fukudamonroeROE-034ROE034roe00034
    • 2021-12-29
    43 min

    H0930 ki220104 Masako Kurosawa 34years old

  • amateur uncensoredh0930
    • 2022-01-13

    [011322-001]The Undisclosed: Do you like my handjob or blowjob？

  • amateur uncensoredhandjobcaribbeancom
    • 2022-01-14
    240 min

    [SREX-004]If You Are An Office Worker Who Works Remotely From Home, Why Don"t You Do A Side Job As A Daddy Without Telling The Company？

  • censoredcreampiebig titsSREXamateur matchups ex daydream tribesSREX-004SREX004srex00004
    • 2022-01-19
    57 min

    324SRTD-0273 Sticking To The Back Of A Female Student Whose Original Intention Is Too Cute!

  • amateur censoreduniformamateursrtdsrtd-0273srtd0273324srtd-0273
    • 2022-02-15
    69 min

    200GANA-2646 Seriously Nampa, First Shot. 1758 Picking Up An Older Sister Who Has Been Slammed For A Schedule And Is Free! A Systemic Erogenous Zone That Switches On Just By Lightly Touching The Legs And Nape! When The Adult-Like Atmosphere Becomes S

  • amateur censoredbig titsamateurganagana-2646gana2646200gana-2646



    • Jav Cherry, watch JAV streaming online japanese xxx