rct




FC2ROYDHMNDTTAWDWAAAMILKHDKAAVSASSISJUFESSNIDASDWANZMVSDMARAAPODSANCESDSTARSAUKG

2020-09-25
265 min

[KFNE-064]Picking Up Real Amateurs At Oktoberfest

  • censoredamateurKFNEprestigekurofune prestigeKFNE-064KFNE064118kfne00064
    • 2020-10-02
    20 min

    FC2PPV 1521375 Weekend only [Individual] A mother of two big breasts, a home with a daughter returning from school, and a husband’s bedroom are fucked by another stick.

  • amateur uncensoredfc2
    • 2020-10-09
    217 min

    [SKMJ-127]Real Pickup With Faces Visible! I Had An Embarassing Sex Experience With A Teenage Girl Who Came To Tokyo From A Rural Area!! Her Pussy Was Full Of Sweet And Sour Juices. I Just Put It In! I Gave Her An Endless Piston Fuck That Never Stoppe

  • censoredcreampieamateurSKMJred face girlkikufukuSKMJ-127SKMJ127h-1324skmj00127
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-11-07
    140 min

    [URKK-031]She Got Played By Horny Department Chief Of Her Client, And Was Creampie Fucked, Over And Over Again Ruka Inaba

  • inaba censoredcreampiebig titsURKKunfinishedrolanda familiar breastURKK-031URKK031urkk00031
    • 2020-11-19
    77 min

    299EWDX-333 Healing K Cup Newlyweds, but my husband can only seed twice a month

  • amateur censoredcreampiebig titsewdxewdx-333ewdx333299ewdx-333
    • 2020-11-22
    239 min

    [REXD-343]Channeling Worried Women Immoral Palm Reading Fortune Teller's Sexual Aura "I Sense A Bad Spirit Coming From You..."

  • censoredcreampieamateurREXDredmanji groupREXD-343REXD343rexd00343
    • 2020-12-06
    146 min

    [GENT-156]What, Really!？ My Favorite Gravure Idol Shows Up For Porn Shoot Interview! After Brainwashing Her Into Becoming A Cum Receptacle It Turns Out She's Actually A Massive Slut So I Fucked Her And Gave Her A Crazy Creampie!

  • censoredcreampiebig titsGENTgentle man mousouzokugentleman mousouzokuGENT-156GENT156gent00156
    • 2020-12-27
    254 min

    [SIGL-001]Amateur Girls Vol. 1: 3 Horny Amateur Girls Getting Raw Creampies

  • censoredcreampiebig titsSIGLshirotogaru mousouzokushiroto guardsSIGL-001SIGL001sigl00001
    • 2021-01-01
    241 min

    [JNK-002]S********l Sex POV Junction vol. 2

  • censoredcreampieuniformJNKprestigejunktionJNK-002JNK002118jnk00002
    • 2021-01-06
    131 min

    [GVH-175]Mamacita Real Stories - Yuria Yoshine

  • yoshine yuria censoredbig titsmomGVHglory questhyonGVH-175GVH17513gvh00175
    • 2021-01-29
    55 min

    [PARATHD-3081]All About The Big Tits: Sex With Braless Busty Babes (6)

  • censoredbig titsPARATHDparadise tvPARATHD-3081PARATHD3081parathd03081
    • 2021-02-04
    47 min

    FC2PPV 1672335 Until 11 1480 [No] Black-haired slender beautiful girl. She is sanctioned and her life ○ vaginal cum shot without escape.

  • amateur uncensoredfc2
    • 2021-02-12
    148 min

    [DASD-815]A Year Of Delinquency - Rui Nanase

  • nanase rui censoredcreampiebeautiful girlDASDdasnao masakiDASD-815DASD815dasd00815
    • 2021-02-12
    31 min

    [CLO-123]Cleavage Shots ... Her Bulging Big Tits Look So Naughty Underneath Her Clothes Haruka Koide

  • haruka koide censoredbig titsblowjobCLOchobitchchovicCLO-123CLO123h-1435clo00123
    • 2021-02-13
    116 min

    [AVSA-155]A Female Director With Big Tits Wearing Pantyhose Who Falls Into Masochism

  • censoredbig titsAVSAavs collector skaoru suzakuavscollector sAVSA-155AVSA155avsa00155
    • 2021-02-19
    142 min

    [KTB-040]The Carnal Office Girl Club 7 - Dispatched From The Office To Satisfy Your Sexual Urges, Miss Misono Will Milk Your Seed - Misono Waka

  • misono waka censoredbig titssingle workKTBkahanshin tigers mousouzokukahanshin tigersKTB-040KTB040ktb00040
    • 2021-03-05
    184 min

    [DOCP-279]The Female Staffer Who Was In Charge Of Showing Real Estate Properties Was U*********sly Shaking Her Tight Ass Was Making Me Horny! Making Sure That No One Was Around, And Unable To Suppress My Lust, I Pulled Her Pants Down And Gave Her A C

  • remi akari shinmura censoredcreampiesquirtingDOCPprestigedocDOCP-279DOCP279118docp00279
    • 2021-03-07
    249 min

    [YMDD-223]A Man For Rent With A Big Dick As Hard As A Bamboo Blade - Beautiful Ladies (Sexual Monsters) Who Want To Conveniently Rent Men To Be Their Sex Toys -

  • censoredsquirtingblowjobYMDDmomotaro eizodukewakamomoYMDD-223YMDD223ymdd00223
    • 2021-03-13
    49 min

    FC2PPV 1724493 Devil’s Blade-Semen Beam Bukkake Creampie by Youkai of the First String [No]

  • amateur uncensoredfc2
    • 2021-03-20
    80 min

    [FUFU-198]True Stories Of First Time Affairs I Triecked My Wife Into Going To Take Care Of A Friend And When They Were Alone Together He Seduced Her... Fumi Miyasawa (40)

  • fumi miyazawa censoredamateursingle workFUFUstar paradisefufuFUFU-198FUFU198h-254fufu00198
    • 2021-03-29
    52 min

    492JCHA-063 Semen of a stranger 2

  • amateur censoreduniformschoolgirljchajcha-063jcha063492jcha-063
    • 2021-04-15
    64 min

    200GANA-2469 In the spear room of the Nampa teacher of 100 battles, bring in SEX hidden shooting 200 Bring a nursery teacher home and havete bed IN! The whip and fair body is attractive! Hidden camera to record the foolery that can never be shown at

  • amateur censoredamateurganagana-2469gana2469200gana-2469
    • 2021-04-18
    118 min

    300MIUM-695 [God development] G milk president secretary is rented as her! Completely REC the whole story that was spoiled up to the originally prohibited erotic acts by persuading! !! Encounter with an erotic older sister so actively that the actor

  • amateur censoredbig titsamateurmiummium-695mium695300mium-695
    • 2021-05-19
    120 min

    [GVH-238]Family Fun Mako Oda

  • oda mako censoredcreampiebig titsGVHglory questkabin kizakuraGVH-238GVH23813gvh00238
    • 2021-05-25
    80 min

    300MAAN-656 [6 pack abdominal muscle beauty athlete] "Ten-chan (20 years old)" who works for sex to unify the world at night. The abdominal muscles that are tightened by a total of 5 toy blame of electric massage machine × 3. rotor × 2 are bi

  • amateur censoredamateurbeautiful girlmaanmaan-656maan656300maan-656
    • 2021-06-01
    38 min

    FC2PPV 1846992 * Discontinued on 6/21 * [First item / outflow] [Caution for immediate deletion] February 2021_This is a video taken when a runaway daughter who dropped out of a certain prefectural general course ② was protected and bred. [Not release

  • amateur uncensoredfc2
    • 2021-06-16
    150 min

    [SSIS-089]She'll Make You Cum Around The Clock - 24 Hours Of Wild Orgasmic Fucking - The Sex Of A Lifetime With Tsukasa Aoi

  • tsukasa aoi censoredsquirtingsingle workSSISs1 no 1 stylemon cSSIS-089SSIS089ssis00089
    • 2021-06-29
    88 min

    300NTK-596 G Cup Reiwa Strongest Body Rookie Gravure! !! Raw chin high from the first low! !! Chuparu Chuparu is discovered as a big fetish! !! Then insert it all the way in pursuit of fetish! !! Shaking G milk! !! Beautiful face panting with pleasur

  • amateur censoredcreampiebig titsntkntk-596ntk596300ntk-596
    • 2021-07-01
    49 min

    H0930 ki210701 Nana Misaki 31years old

  • amateur uncensoredh0930
    • 2021-07-02
    152 min

    [JUL-646]

  • osamu osamu censoredcreampiemature womanJULmadonnabieber gonzoJUL-646JUL646jul00646
    • 2021-07-14
    180 min

    [PPPD-945]F-Cup Lingerie Saleswoman Hikari Kisaki Demonstrates Her Seductive Sales Tactics

  • hikari hime censoredcreampiebig titsPPPDoppaiPPPD-945PPPD945pppd00945
    • 2021-07-17
    57 min

    H0930 tk0038 Mikiko Ogami 40years Old

  • amateur uncensoredh0930
    • 2021-07-18
    243 min

    [NASH-544]Horny Mature Women! Works Carefully Selected By Our Stuff ! Piss Juices Overflowing To The Max! You Will Definitely Get Off! 4 Hours Of Older Women Having Thick, Rich Sex

  • censoredcreampiebig titsNASHnadeshikoNASH-544NASH544nash00544
    • 2021-07-19
    76 min

    FC2PPV 1930903 [9980 → First Time Limited 2980] First Shot ❤️ Cute Child Who Came To Tokyo At The Time Of Admission ❤️ Complete Appearance Of A Miracle By Squeezing The Power Of Adults ❤️ Cum Shot With The Second Cock In Life ❤️ Naka Is Useless ̷

  • amateur uncensoredfc2
    • 2021-07-23
    160 min

    [LULU-083]I Took Advantage Of The Gorgeous Madonna Who Peed Herself At The Class Reunion After Party And Made Her Into My Married Sex Pet! Runa Tsukino

  • tsukino luna censoredcreampiesingle workLULUlunaticsvagmanLULU-083LULU083lulu00083
    • 2021-07-27
    120 min

    [SAN-011]I Let My Manager With The Big Dick Fuck Me At My Part Time Job -Shion Nagisawa

  • nagisawa shion censoredcreampiebig titsSANmothermother motherSAN-011SAN011h-796san00011
    • 2021-07-31
    102 min

    [VENX-064]The Stepmother and Stepson Who Get It On Two Seconds After The Stepfather Goes Out. Ayane Sezaki.

  • ayane sezaki censoredcreampiebig titsVENXvenuskitano majimeincest vi nasuVENX-064VENX064venx00064
    • 2021-08-06
    50 min

    H4610 gol206 Natsuki Kuramoto 21years Old

  • amateur uncensoredh4610
    • 2021-08-06
    55 min

    480FRIN-044 << Personal Shooting >> Beautiful Charisma Model Affair Video Leaked Former J ● Exclusive Big Tits Model Cum Inside In A Secret Meeting With A Big Day Big P

  • amateur censoredcreampiebig titsfrinfrin-044frin044480frin-044
    • 2021-08-14
    175 min

    [KAGP-193]Amateur Girl Is Actually Amazing At Blowjobs, 10 Modern Amateurs Met Online, 180 Minutes

  • censoredamateurblowjobKAGPkaguya hime pt mousozokutsumatori no okinakaguya hime ptKAGP-193KAGP193kagp00193
    • 2021-08-24
    60 min

    10musume 082421_01 Slimy Big Breasts In Competitive Swimsuit Rino Kudo

  • amateur uncensored10musume
    • 2021-08-29
    115 min

    [083PPP-2220]【モロ見え注意】大学生カップルがラブホでハメ撮り配信(2) 完全版

  • amateur censoredamateurpppppp-2220ppp2220083ppp-2220
    • 2021-09-30
    63 min

    Pacopacomama 093021_539 The Training For Wife: Training A Vulgar Married Woman Full Of Elegance Chisato Nishiyama

  • amateur uncensoredpacopacomama
    • 2021-10-03
    47 min

    358WITH-106 Ema (19) S-Cute With Masturbation-Loving Black-Haired Beauty And Gonzo H (Choyo Ema)

  • amateur censoredamateurbeautiful girlwithwith-106with106358with-106
    • 2021-10-15
    174 min

    [MEYD-710]A 33-Year Old Married Woman Who Lives In The 3-Chome District Of Setagaya Is Making Her Adult Video Debut Reika-san

  • censoredMEYDtameike gorotakarase hironoriMEYD-710MEYD710meyd00710
    • 2021-11-02
    210 min

    [SVDVD-884]Hold Out And Win A Prize! If You Fail It"s Instant Penetration By Huge Cock! Teen College Girl Squatting Face Sitting Cunnilingus Challenge! She Cum And Squirts Over And Over Again As The Hood On Her Sensitive Clit Is Peeled Back And L

  • censoredcreampiesquirtingSVDVDsadistic villagenyu kaji kazamashirouto sanka varietySVDVD-884SVDVD8841svdvd00884
    • 2021-11-05
    137 min

    [JUL-762]The Never-ending Days Of Creampie Rinka Tahara

  • rinka tahara censoredcreampiebig titsJULmadonnaunicorn fukudaJUL-762JUL762jul00762
    • 2021-11-06
    163 min

    [FLAV-283]HYPER FETISH High-legged Slutty Queen Hazuki Wakamiya

  • wakamiya censoredslutsingle workFLAVdigital arkdigital ark dejitarua kuFLAV-283FLAV283flav00283
    • 2021-11-08
    94 min

    496SKIV-021 Momo-Chan (19)

  • amateur censoredcreampieamateurskivskiv-021skiv021496skiv-021
    • 2021-11-11
    162 min

    [NHDTB-599]Public Bath Lesbian Compliant Touching - Lesbian Plan Using A Slutty Daughter

  • censoredlesbianNHDTBnatural highrafutin maeshiroNHDTB-599NHDTB5991nhdtb00599
    • 2021-11-19
    41 min

    SKHO-018 Hono (Yoshimi Hono)

  • amateur censoredcreampieschoolgirlskhoskho-018skho018skho-018
    • 2021-12-02
    75 min

    [REBD-609]Kanan Twinkle Tropical. Kanan Amamiya

  • amamiya hanan censoredsingle workREBDrebeccataiga kosakaiREBD-609REBD609h-346rebd00609
    • 2021-12-07
    50 min

    FC2PPV 2496541 [No] Sister-Based Beautiful Girl Miku-Chan And Icharab Gonzo ♡ Intense Blowjob That Sucks Ojisan Semen With A Pure Innocent Face ♥ Ignore "Get Out ♡" And Legally Vaginal Cum Shot!

  • amateur uncensoredfc2
    • 2021-12-09
    221 min

    [PIYO-131]A Romantic Dream Of Men! We Searched For A Secret Coed Hot Spring Bath ... (While Hiding Our Ulterior Motives) When We Entered The Coed Bath, We Found Ourselves Faced With Naive And Precocious Girls Who Will Milk Your Cocks Until They Go Li

  • censoredcreampieschoolgirlPIYOhiyokopiero taPIYO-131PIYO1311piyo00131
    • 2021-12-09
    116 min

    [GS-415]Sexy Welcome Party With Our Hot Female Coworker At First She Seemed Nervous To Party With Us, But Once We Got Her Going And Started Touching Her She Got Super Turned On And Wanted To Kiss Us! After Getting Excited By All The Deep Tongue Kissi

  • censoredGSsosoru x garcontumblerGS-415GS415h-101gs00415



    • Jav Cherry, watch JAV streaming online japanese xxx