over hours javcensored censored jav def




FC2GVHSANROYDHMNEBODCJODDASDSHKDSSISMIDEAWDWAAAFSDSSSQTEKSBJPPPDCHRVNACXKBISDAB

2020-09-17
118 min

[PPPD-871]Horny Semen Big Tits Bukkake Unequaled Large Orgies! 213 ejaculations! Eimi Fukada

  • emi fukada censoredcreampiebig titsPPPDoppaiPPPD-871PPPD871pppd00871
    • 2020-09-18
    146 min

    [HODV-21513]Fresh Face AV Debut S*****t At The Famous K University And Amateur Fashion Model Itsuki Hasegawa Age 19

  • hasegawa ju censoredbeautiful girlsingle workHODVh m phimu lockHODV-21513HODV215135642hodv21513
    • 2020-09-18
    59 min

    10musume 091920_01 Rich sex with a lot of lotion on a healthy school girl Hikari Endo

  • amateur uncensored10musume
    • 2020-09-21
    57 min

    328HMDN-296 [Oni cock x married woman] Married woman 32 years old in the third year of marriage Reho-san Exposing the face that her husband does not know to the big cock that penetrates Portio and seeking vaginal cum shot as instinct Nasty cheating w

  • amateur censoredcreampiemarried womanhmdnhmdn-296hmdn296328hmdn-296
    • 2020-09-22
    59 min

    Pacopacomama 092220_361 Ayaka Ichii

  • ayaka ichii uncensoredcreampieblowjobpacopacomama
    • 2020-09-27
    94 min

    345SIMM-516 Delusional masturbation with boys in class! ？？ 169cm model body, Takamine’s flower of the tennis club is a moody onanist! Electric massage, urination, footjob, raw squirrel … I love everything that feels good ♪ Hedonistic J ○ an

  • amateur censoredcreampieuniformsimmsimm-516simm516345simm-516
    • 2020-10-09
    52 min

    [oretd-772]AKASEさん

  • amateur censoredcreampieamateuroretdoretd-772oretd772oretd-772
    • 2020-10-14
    126 min

    [GVH-139]Mom's Real Sex Education - Mio Kimishima

  • kimishima mio censoredbig titsmomGVHglory questtsunemori takahashiGVH-139GVH13913gvh00139
    • 2020-10-18
    17 min

    FC2PPV 1538613 Limited 30 discount [Individual] A married woman who is blindfolded and insulted by her husband because of a secret debt

  • amateur uncensoredfc2
    • 2020-11-07
    152 min

    [KTSG-008]What's In This Elder Sister Type's Closet？ Reprint Edition Cums With Bonus Footage Of Bras

  • yuki natsume yamamoto miwako censoreduniformlingerieKTSGkahanshin tigers mousouzokukahanshin tigersKTSG-008KTSG008ktsg00008
    • 2020-11-18
    59 min

    [SDFK-036]The Magic Mirror Number Bus "Would You Please Help Out A Cherry Boy With His Masturbation...？" We Went To The Beach And Asked Kind And Gentle Beautiful Girls In Swimsuits To Help Out A Cherry Boy, And They Bashfully Agreed! Misa (20

  • censoredbig titsSDFKsod createsaijo akiramagic mirrorSDFK-036SDFK0361sdfk00036
    • 2020-11-19
    119 min

    [SSNI-924]Pissing, Squirting And Cumming: Big Dick Splashy Piston Fucking Until She Can't Hold It In - First Time Ever! Super Mega Flood Orgasm! Sayaka Otoshiro

  • otoshiro sayaka censoredsquirtingbeautiful girlSSNIs1 no 1 stylekyoseiSSNI-924SSNI924ssni00924
    • 2020-12-18
    115 min

    [HZGD-172]NTR My Neighbor Lured My Husband To Temptation And Fucked Him... This Horny Bitch Slut Wife Used Her Light Skin And Beautiful Big Tits To Toy With All Of The Men In The Village And Lure Them To Creampie Sex Hina Nanami

  • hina nanami hina nanase censoredcreampiebig titsHZGDmarried woman flower garden theaterhirokoji osakiimage married woman flower garden theatHZGD-172HZGD172h-1100hzgd00172
    • 2020-12-21
    149 min

    [AVSA-150]A New Generation Bisexual Cute And Lusty Transsexual A Shemale Lesbian x Clit & Cock Sensual Awakening S&M Breaking In Training

  • namiki touko beatrix censoredlesbianbdsmAVSAavs collector ssanpei yuyuavscollector sAVSA-150AVSA150avsa00150
    • 2020-12-26
    120 min

    [WAAA-024]"I'm Having A Problem With My Husband. He's So Horny!" A Husband-And-Wife Swap For A Horny Pussy-Eating Buffet A Rude And Crude Lust-Comparing Reverse Threesome Harlem Fuck Fest! Ayaka Mochizuki Misato Nonomiya

  • ayaka mochizuki nonomiya misato censoredcreampiebig titsWAAAwanz factorywanzWAAA-024WAAA024waaa00024
    • 2021-01-01
    134 min

    [EKDV-652]Natsu Tojo Makes Males Subs Cum Buckets! These Desperate Guys Plead To Get Off And Natsu Makes Their Dreams Cum True!

  • natsu tojo censoredcreampiesquirtingEKDVcrystal picturekintaro okumae kissEKDV-652EKDV65249ekdv00652
    • 2021-01-17
    302 min

    [LZBS-067]The Top 24 Anal-Loving Lesbians In The Biz! 5-Hour Select BEST Collection - Big Booty Babes VS Anal Sex

  • mitani akari otsuki sound censoredanallesbianLZBSlesrebest lesbian playLZBS-067LZBS067lzbs00067
    • 2021-01-30
    46 min

    FC2PPV 1641105 [Personal shooting] Noriko 22 years old ★ G cup big breasts nail technician! I will give a vaginal cum shot to a dirty girl who loves blowjob!

  • amateur uncensoredfc2
    • 2021-02-06
    31 min

    FC2PPV 1675445 Limited to 3 days [Individual] Beautiful wife of a spender. She can not repay and is taken to the room and vaginal cum shot in her raw vagina

  • amateur uncensoredfc2
    • 2021-02-06
    200 min

    [HUNTA-942]"I'm Surprised At How Big Your Tits Are..." "This Is So Embarrassing... Please Don't Stare At Them..." "Don't Worry, I'm Not Interested In A K*d Like You..." This Little Stepsister Has Secretly

  • censoredbig titsschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-942HUNTA942hunta00942
    • 2021-03-13
    151 min

    [IPX-628]Creampie SEX Revealed Momo Sakura

  • sakura sky momo censoredcreampiebig titsIPXidea pocketusa pyondishIPX-628IPX628ipx00628
    • 2021-03-19
    65 min

    FC2PPV 1733170 [Race Queen Highleg x Super Glossy Pantyhose] <4K Shooting> Tall slender body pantyhose leg line beauty & biting pussy is too erotic!Fully dressed fuck obscenely by shifting the highleg with a perverted leotard !!

  • amateur uncensoredfc2
    • 2021-03-21
    175 min

    [CJOD-287]Limitless Ejaculation Soapland Getting Brought To Orgasm Squeezed In Between Two Plain Jane Glasses Wearing Big Titty Sluts With Thick Bodies! Nanami Matsumoto Nenne Ui

  • nana matsumoto first love censoredcreampiebig titsCJODchijo heavenmametaro mamezawaCJOD-287CJOD287cjod00287
    • 2021-03-25
    62 min

    FCP-007 [Delivery only] "What did you do？ you can not sleep？ I’ll do something comfortable and let you lie down … ”Ultimate healing erotic! Co-sleeping handjob! !! ＃ 2

  • amateur censoredbig titsamateurfcpfcp-007fcp007fcp-007
    • 2021-03-26
    130 min

    [GNAX-049]Sex Servant After School I Am A Sex Toy For My Classmates Noa Eikawa

  • sakaegawa noa censoredcreampieuniformGNAXnagirakazumaGNAX-049GNAX049h-1345gnax00049
    • 2021-03-26
    181 min

    [JUFE-271]Her Plain Glasses Can't Hide This Office Beauty's Endless Lust - Her Raw Porn Debut! Karen Yuzuriha, Age 24 - Spending More Time At Home Has Given Her More Time To Daydream About Erotic Scenarios, And Her Masturbation Counter Is Off

  • karen kaede censoredbig titsdeepthroatJUFEfitchJUFE-271JUFE271jufe00271
    • 2021-04-02
    121 min

    [NDRA-086]The Wife Who Became The Neighbor's Lover 33 Mio Kimijima

  • kimishima mio censoredbig titsmature womanNDRAjet eizomanji groupNDRA-086NDRA086ndra00086
    • 2021-04-08
    130 min

    [MEKO-209]New "Rental MILF" Service 12 - They Say You Can Give Them A Creampie So We Tried Asking For Even More Extreme Services

  • censoredcreampieamateurMEKOmilf laboMEKO-209MEKO209h-1160meko00209
    • 2021-04-09
    206 min

    [SKMJ-160]Right After Her Graduation Ceremony, This Sch**lgirl Went Over To Her Favorite Teacher's House To Spend The Night (Hearts) "Teacher (Hearts), Let's Have Lots And Lots Of Sex (LOL)" And Then They Had Lovey-Dovey (Hearts) Crea

  • censoredcreampieschoolgirlSKMJred face girlSKMJ-160SKMJ160h-1324skmj00160
    • 2021-04-24
    44 min

    H4610 tk0033 Mika Sumiyama 20years old

  • amateur uncensoredh4610
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-07
    131 min

    [HBAD-583]Big Titty Home Delivery College Girl Anime Otaku And Cosplayer With Huge Tits Loves Older Men! Her Whole Body Is A Sexual Organ That Has Her Cumming Over And Over!

  • censoredbig titscosplayHBADhibinobabeHBAD-583HBAD5831hbad00583
    • 2021-05-14
    175 min

    [RKI-611]This Woman Is A Sex Monster Model Physique Porn Video Discovery Of The Ultimate Sexy And Beautiful Amateur Noa

  • censoredcreampieblowjobRKIrookieRKI-611RKI611rki00611
    • 2021-05-14
    119 min

    [PPPD-930]Extremely Sensitive Breasts!! Sex with You: Taking Some Aphrodisiacs And Giving An Indecent Raw Creampie At An Erotic Spa!! Miku Maina

  • maina miku censoredcreampiebig titsPPPDoppaiPPPD-930PPPD930pppd00930
    • 2021-05-21
    117 min

    [NNPJ-448]This Is The First Time I've Ever Used A Dating App To Meet Men... Bored, Sex-Starved Married Woman Goes To A Love Hotel Just This Once With Another Man Ms Aki

  • censoredcreampiebig titsNNPJnanpa japanNNPJ-448NNPJ448nnpj00448
    • 2021-05-29
    123 min

    [RPIN-052]A Beautiful Designer Who Loves Cocks These Cheerful And Crude Ladies Are Having Fun And Are Down For Threesomes, Dick Sucking, Shame, And Suffocating Cock-Thrusting Orgasms!

  • censoredRPINlycopene mousouzokukakeru ozoraRPIN-052RPIN052rpin00052
    • 2021-06-25
    75 min

    [HYPN-043]Gyaru Who Makes Fun Of The Janitor Turns Into His Slut! A Whore Who Sucks Your Dirty Cock Clean With Her Mouth! Mitsuki Maya

  • aya mitsuki censoredcreampieblowjobHYPNsod createsatoshi morikawamind controlHYPN-043HYPN0431hypn00043
    • 2021-06-25

    FC2PPV 1888333 Weekend only [Uncensored] 170cm model body Y〇uTuber ・ Sex in a private and multipurpose toilet. Continuous vaginal cum shot at the hotel

  • amateur uncensoredfc2
    • 2021-07-01
    121 min

    [CLOT-019]Pantyhose Temptation - Karen Otoha

  • karen otoha censoredcreampiesingle workCLOTplanet plusdirector ocloseCLOT-019CLOT019h-237clot00019
    • 2021-07-07
    110 min

    428SUKE-078 [There is a private room beauty treatment salon] RENA-chan ★ A lewd beauty with a soft big butt appears in the G cup! Handjob Este → Raw Saddle Detox! ？？ Change into a brilliant bikini and play the second round! I’ll make your skin b

  • rena censoredcreampiebig titssukesuke-078suke078428suke-078
    • 2021-07-10
    127 min

    [MDS-893]A Trip to an Orgy at an Onsen with a Neat and Clean Bitch with Black Hair. Urara Kaon.

  • hanaoto urara censoredcreampiebeautiful girlMDSuchu kikakumiyaba memberMDS-893MDS893mds00893
    • 2021-07-28
    200 min

    [HHH-239]Confidential Amateur Prank Video: Pulled Out My Dick While Getting My Pants Hemmed

  • censoredamateurHHHtriple hrasukaruHHH-239HHH23978hhh00239
    • 2021-07-29
    74 min

    FC2PPV 1945219 A 10-Year-Old Girl Until 3 Days Ago. She Changed Completely From Her Expression With Sorrow. She Thrusts Her Cock Into Her Throat And Her Full Erection Is Inevitable. Sex Seeded On An Immature Body That Was Used As An Outlet For Uncle&

  • amateur uncensoredfc2
    • 2021-08-18
    32 min

    FC2PPV 2039969 Limited Number! !! [Uncensored] Fornication With A Beautiful Girl Reader Model With An Idol Face! Creampie In An Outstanding Slim Body! !!

  • amateur uncensoredfc2
    • 2021-09-03
    128 min

    [HODV-21606]Ultimate Masochist Wants To Be Trained So Pain Makes Her Cum. Kana Tanaka

  • kana nakata censoredcreampiedeepthroatHODVh m pHODV-21606HODV216065642hodv21606
    • 2021-09-09
    207 min

    [DANDY-780]This S********l Came To See Me In The Hospital And She Got Me Hard By Flashing Panty Shot Action At Me And Teased Me With A Blowjob And Made Me Cum And When My Dick Was Super Sensualized She Started Sucking On My Tip And Gave Me A Cleanup

  • censoredschoolgirlblowjobDANDYdandykenkyo momoiroDANDY-780DANDY7801dandy00780
    • 2021-09-25
    159 min

    [DGCEMD-060]*For Streaming Editions Only! Cums With Bonus Footage* She"s Using Her Crude And Vulgar Snake-Like Tongue At The Dirty Talk Counseling Bar Honoka Tsujii I"ll Resolve All Of Your Perverted Problems With My Snake Tongue!

  • tsujii honoka censoredbig titsmature womanDGCEMDcelebrity friendsDGCEMD-060DGCEMD060dgcemd00060
    • 2021-10-01
    51 min

    491TKWA-195 Big Tits Gal J ● And Raw Creampie! (Takehiro Tomiyasu)

  • amateur censoredcreampieuniformtkwatkwa-195tkwa195491tkwa-195
    • 2021-10-06
    78 min

    Caribbeancom 100621-001 The Undisclosed: Stunning Blowjob Experience Chisato Takayama, Yui Kawagoe, Rena Sanka, Maki Koizumi

  • amateur uncensoredcaribbeancom
    • 2021-10-15
    119 min

    [BLK-530]C***dhood Friend Is A Bratty Gal That Ends Up Sharing A Bed Right Next To Me At The School Nurse"s Office, We Cut Class So We Can Fuck All Day Long Till I"m Empty Of Cum! Wan Horikita

  • horikita wan censoredcreampieblowjobBLKkira kirakira hosi kira black galBLK-530BLK530blk00530
    • 2021-10-22
    101 min

    300MIUM-753 Hiroshi ● Ana Very Similar! !! !! [E-Cup Beautiful Breasts X Plump Nice Ass X Three Beautiful Legs With Glossy Legs Erotic Body] X [Nurunuruma That Becomes Sensitive Enough To Stir] X [Nailed Cowgirl That Shakes Plump Nice Ass And Cums] D

  • amateur censoredsquirtingamateurmiummium-753mium753300mium-753
    • 2021-10-29
    25 min

    FC2PPV 2385149 Limited Number! Appearance! "# 12" Active Nurse. With The Opening Of Metamorphosis, "Nyan ♡ Nyan ♡" Cowgirl Mass Cum Shot ♡ Both Feelings ♡

  • amateur uncensoredfc2
    • 2021-11-01
    68 min

    230OREC-919 Fuwarin (Hino Fuwari)

  • amateur censoredcreampiebig titsorecorec-919orec919230orec-919
    • 2021-11-20
    117 min

    [AGAV-068]Saliva Gal S*****t - Tongue Kissing Nipple Saliva Circle Light Intercourse With Dominant Uncle - Nagisa Himawari

  • sunflower censoredbeautiful girlslutAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-068AGAV068agav00068
    • 2021-12-10
    24 min

    FC2PPV 2504844 Immediate Scale 3 People Continuously Mass Fired In The Car Dedicated To Blowjob In The Middle Of The Day. Finally Live In The Car, It Feels Too Comfortable And A Large Amount Of Vaginal Cum Shot ☆ Mizuki-Chan, A Beautician Who Likes B

  • amateur uncensoredfc2
    • 2022-01-04
    85 min

    451HHH-041 [Almost A Virgin AV! ？？ ] [Ubu Kawa Healthy Deep Throating] [Man Juice Grows Too Much Toro Toro Ma ● This Is A Big Jet] I Thought That It Was A Pure Girl Raised In The Countryside With Clear Eyes The Expression That Distorts The Beautiful

  • amateur censoredcreampiesquirtinghhhhhh-041hhh041451hhh-041



    • Jav Cherry, watch JAV streaming online japanese xxx