lotion oil jav creampie censored titty fuck




FC2ONEZKBIAUKGDTTAPODPPPDMIAASSNISSISADNNGODSDABSHKDCHRVAVSANATRHNDAWDPREDMIDV

2020-10-04
135 min

[DNJR-037]Dirty Talk Is This Wild Busty Broadcaster Prof's Specialty, And There's Nothing She Loves More Than Teasing Guys Nipples Chihaya Akimoto

  • akimoto chihaya censoredslutsingle workDNJRdog daydreamersmaboroshikoDNJR-037DNJR037dnjr00037
    • 2020-10-30
    58 min

    FC2PPV 1552312 [No / Amateur Individual Shooting] Secretly shoot Miss Deriheru who is good at blaming with sex appeal! The words you speak are exciting! I almost fell in love with it. After negotiations, please enjoy the whole story of the delivery h

  • amateur uncensoredfc2
    • 2020-10-31
    70 min

    300MIUM-635 [Carnivorous China Cosplay JD] The eight-headed slender super beautiful legs JD working at the concept cafe is a super carnivorous system that both customers and store managers eat! A national treasure-class pure white snow skin that will

  • amateur censoredamateurmiummium-635mium635300mium-635
    • 2020-10-31
    146 min

    [WAAA-005]Horny Slut Shares A Room With Naughty Barely Legal Boy! They Spend The Night At A Hotel Together While He Pumps Her Full Of Creampie After Creampie... ! Yui Hatano

  • yui hatano censoredcreampiebig titsWAAAwanz factorygoemonwanzWAAA-005WAAA005waaa00005
    • 2020-11-24
    43 min

    [NYH-061]After Being Lured By A Glance Of My Friend's Stepmom's Panties, She Squeezes My Cock Hard With Her Big Tits and Huge Ass Kurea Hasumi

  • hasumi claire censoredmarried womanslutNYHdirectorsdirectorsnyanjiang houseNYH-061NYH0611nyh00061
    • 2020-11-27
    264 min

    [KFNE-068]Got Me A Barely Legal Runaway

  • censoredcreampieamateurKFNEprestigekurofune prestigeKFNE-068KFNE068118kfne00068
    • 2020-11-28
    155 min

    [MMND-192]"Can't Do AV" 99 Cm H-Cup A Quiet Looking Incredibly Slutty And Silent Big Tits Glasses Girl Age 19 Nenne Ui

  • first love censoredbig titssingle workMMNDmimanyuki iwasawaMMND-192MMND192mmnd00192
    • 2020-12-01
    94 min

    FC2PPV 1575406 [Yariman model] Emi [Individual shooting] Bring slender nice ass who came in for model recruitment to the room and defeat it and cum inside! Panchira Peace (Onikawa) Ahegao Piece (Geki Erotic) Creampie [With warehousing bonus]

  • amateur uncensoredfc2
    • 2020-12-03
    242 min

    [SHIC-177]My StepK*d 4-Hour Collection 4

  • censoredbeautiful girlSHICshishunki.comSHIC-177SHIC177
    • 2020-12-17
    240 min

    [HUNTA-910]"What？ You're Going To Do That For Me Too？？ But I'm Going To Cum!!" An Angel In White Has Cum Down To Earth! She'll Suck And Slurp Up Every Last Drop Of My Semen With Her Tight Pussy Vacuum-Powered Cowgirl...

  • censoredcreampieuniformHUNTAhuntervolvo nakanohhh groupHUNTA-910HUNTA910hunta00910
    • 2020-12-25
    133 min

    [TYD-003]Uniformed Girl's Squeaky XXX Bus

  • otohana eve mei narukawa censoreduniformTYDdream ticketthousand holidayTYD-003TYD00324tyd00003
    • 2021-01-01
    237 min

    [DOCP-267]"Forgive Me, Please Let Me Cum!!" I Inserted It Into The Erotic Huge Ass Of The Beautiful Stuff Dispatched By The Housekeeping Service!! Piston Creampie, 25 Shots!!!

  • yuki s chiharu miyazawa censoredcreampiedeepthroatDOCPprestigedoc premiumDOCP-267DOCP267118docp00267
    • 2021-01-10
    133 min

    [KYMI-010]High-Class Slut With Big Tits Pleasures Guys Fully Clothed In A Hotel Suite - H-Cup In A High-Legged Leotard Yuri Honma

  • really censoredbig titsslutKYMImiluaida yumenoKYMI-010KYMI010kymi00010
    • 2021-01-22
    46 min

    [DHT-224]Amateur Wives With A Reason To Cheat - She Gets Her Bills Paid Through A Hookup App - Hot Married Woman Chinatsu, Age 28

  • censoredbig titsmarried womanDHThot entertainmentmohri smithDHT-224DHT22459dht00224
    • 2021-01-24
    125 min

    [TWYB-002]The Forbidden Secret Part-time Job Of Local Teachers - Natsuno Ayamine

  • natsuno ayamine censoredcreampiebig titsTWYBtoyohikotoyohikotoyohiko kikakuTWYB-002TWYB002twyb00002
    • 2021-02-12
    120 min

    [MUDR-140]We've Been Waiting One Whole Year! Coquettishly Cute Local Broadcaster Shows Off Her Cowgirl SK**ls At Soapland Brothel In This Popular Let's Play Style Porno! Tsumugi Narita

  • narita tsumugi censoredcreampiebeautiful girlMUDRmukuMUDR-140MUDR140mudr00140
    • 2021-02-26
    60 min

    FC2PPV 1703023 Until 2/28! 3980pt → 1990pt [Squirting] [Creampie] In response to many requests, a female college student with D cup beautiful breasts & beautiful face reappears!

  • amateur uncensoredfc2
    • 2021-03-01
    80 min

    [HKHS-011]LUCKY YOU Your Destiny Nora Hollywood Girl Made Into A Sex Servant By Japanese Tourists

  • censoredcreampiemarried womanHKHShikara delusion groupsamuraiHKHS-011HKHS011hkhs00011
    • 2021-03-05
    240 min

    [SOUD-031]College Girl Gets Naughty! Too Real Completely Private POV Collection!

  • censoredamateurbeautiful girlSOUDprestigestrongest chome chomeSOUD-031SOUD031118soud00031
    • 2021-03-06
    119 min

    [JUL-499]This Married Woman Cabin Attendant Is Getting Lathered Up With Aphrodisiacs And Falling For Creampie Sex, And Getting Fucked Over And Over Again By A Menial Laborer In This Breaking In Video Record. Yu Shinoda

  • shinoda yu censoredcreampiebig titsJULmadonnabungo maedaJUL-499JUL499jul00499
    • 2021-03-17
    49 min

    FC2PPV 1730047 Meychan’s latest work! !! I won’t lose to my sister! I tried to reverse Nan, but tears. Tears. Creampie etch from! !!

  • amateur uncensoredfc2
    • 2021-03-19
    120 min

    [AQSH-066]Married Housewife Is Made Into A Sex Toy By Her Husband's Boss Mako Shion

  • miko shion censoredcreampiemature womanAQSHaquamall heroaquamallAQSH-066AQSH066aqsh00066
    • 2021-03-21
    120 min

    [JUL-508]Steamy Sex ~ Married Nurse Gives Herself Up To A Patient's Warmth ~ Asahi Mizuno

  • mizuno chaoyang censoredbig titsmature womanJULmadonnarokusaburo mishimaJUL-508JUL508jul00508
    • 2021-03-24
    49 min

    444KING-032 Honoka (20)

  • amateur censoredcreampiebig titskingking-032king032444king-032
    • 2021-04-02
    70 min

    328HMDN-350 [Individual / F Cup] Cheating Athlete Wife 47 Years Old And Creampie Affair. Beast sex that shakes hips with a young raw meat stick to devour

  • amateur censoredcreampiemarried womanhmdnhmdn-350hmdn350328hmdn-350
    • 2021-04-08
    18 min

    FC2PPV 1760080 [Ochinpo Shine / Kurairi Series ④] I was begged by a tall volleyball girl, so I made a raw fuck and a large amount of vaginal cum shot! ？？ 2nd ① Creampie [Karen-chan] Blow specialization

  • amateur uncensoredfc2
    • 2021-04-10
    43 min

    C0930 hitozuma1352 Kaho Kagaya 26years old

  • amateur uncensoredc0930
    • 2021-05-01
    187 min

    [NKKD-205]Married Woman Gets Nailed In A Pubic Bathroom While On A Drive With Her Family! 6 Toilet Cheating

  • censoredmature womanNKKDjet eizomanji groupNKKD-205NKKD205nkkd00205
    • 2021-05-14
    120 min

    [BLK-499]"I Can't Believe This... I Haven't Touched Myself In Ages, I'm So Wet" Desperately Horny Gal Has Her Boyfriend Cancel Their Date At The Last Minute! She's Pissed Off At Him And Ready To Cheat - Fucking A Gorgeous Gir

  • censoredcreampiebig titsBLKkira kirakira kira black galBLK-499BLK499blk00499
    • 2021-05-22
    123 min

    [AVSA-167]Slutty Girl With A Sexy Tongue AIKA

  • aika censoredslutsingle workAVSAavs collector sbuddha davscollector sAVSA-167AVSA167avsa00167
    • 2021-05-22
    138 min

    [CEMD-011]5 Seconds Before Your Dick Breaks! SEX With A Full-course Slut That Doesn't Hold Back - Honoka Tsujii

  • tsujii honoka censoredbig titsblowjobCEMDceleb no tomoCEMD-011CEMD011cemd00011
    • 2021-06-05
    240 min

    [MMB-369]Ultimate Service By A Beautiful Hostess! Welcome To The Raw Sex Japanese Inn!

  • mai hebei melody mark censoredcreampieMMBmomotaro video publishingdr ishikiri bridgemomotaro bestMMB-369MMB369mmb00369
    • 2021-06-09
    79 min

    522DHT-259 [The abomination of the wife who sheds tears and accepts Irama! ] Suck with a slump! Stick your cheeks from the side and expose your face! The vibe is inserted and removed by yourself and the lewd juice spouts many times! "It’s th

  • amateur censoredcreampiebig titsdhtdht-259dht259522dht-259
    • 2021-06-10
    179 min

    [NHDTB-540]We Hate Our Gross Step Father, But... Big Titty Step Sisters Are Given Aphrodisiacs And Become So Horny They Fight Over Their Step Father's Dick And Fuck Him At The Same Time

  • censoredbig titssisterNHDTBnatural highkansukeNHDTB-540NHDTB5401nhdtb00540
    • 2021-06-16
    151 min

    [SSIS-101]Climax! Natural H-Cup Girl With A Greedy Body Super Climaxing Shaking And Writhing 3 Rounds Konan Koyoi

  • koyoi konan censoredbig titssingle workSSISs1 no 1 stylemon cSSIS-101SSIS101ssis00101
    • 2021-07-02
    226 min

    [HUNTB-046]Wearing Clothes That Are Loose and Baggy Will Make Your Tits Hang Out!! Drip Drip Drip...Maybe She Is Really Showing Her Tits On Purpose？

  • censoredcreampiehandjobHUNTBhuntermorikihhh groupHUNTB-046HUNTB046huntb00046
    • 2021-07-30
    85 min

    483SGK-035 "Unrivaled Ji ● Po Love" "Innocent Girl In The Country" "Gutchori Wet Wet Constitution" "Ecchi For The First Time In A Year" "Super Do M Ichayo Climax" A Country Girl Working At A Factory From T

  • amateur censoredamateursgksgk-035sgk035483sgk-035
    • 2021-08-10
    153 min

    [KMHRS-047]Slowly Developing Secret Slut"s Hidden Personality Until She Cums With Her Whole Body Wet, Noel Honda

  • honda noeru censoredsquirtingamateurKMHRSsod createkaorukimihoreKMHRS-047KMHRS0471kmhrs00047
    • 2021-08-21
    57 min

    H4610 ki210822 Chika Yoshimoto 33years old

  • amateur uncensoredh4610
    • 2021-08-21
    125 min

    [MNTL-001]Slut H Cup Thick Curvy Woman, Chisato Koda

  • chisato koda censoredcreampiebig titsMNTLtoyohikozarakiyasushiun kaiMNTL-001MNTL001mntl00001
    • 2021-08-21
    80 min

    FC2PPV 2059595 [9980 → Weekend Limited 2980] A Neat And Elegant 22-Year-Old G-Cup Nursing Student ❤️ Miracle Gonzo ❤️ Eyes Bluntly Die With A Generalized Erogenous Zone ❤️ Ahegao Opens Up Sexual Desire ❤️ Boiling Ejaculation At The Uterine Ostium ❤️

  • amateur uncensoredfc2
    • 2021-08-26
    138 min

    [HAWA-257]The Mom Bitch Who Loves Dick Has A Harem [All Ejaculation Before Going Home]

  • censoredcreampieamateurHAWAkosumosu eizounagase hawaicosmospictures soft on demandHAWA-257HAWA2571hawa00257
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-25
    131 min

    [LZPL-060]Tongue Heavy Lesbian Kissing Sex, Lewd Lesbian Full Body Drooling. Yumi Saeki ka, Reira Kuon

  • yuka saeki leira haduki censoredlesbianslutLZPLlez reflagmanlez re playLZPL-060LZPL060lzpl00060
    • 2021-09-27
    89 min

    300MIUM-755 [This Married Woman Is The Most Dangerous! ] A Hardcore "De Metamorphosis!" That Has Been Staring At The Crotch Of Boys Since Elementary School. !! !! 』 De M Wife Who Loves Painful Irama Anyway! !! [Excessive Blowjob Desire] Immed

  • amateur censoredcreampiebig titsmiummium-755mium755300mium-755
    • 2021-10-01
    153 min

    [MIFD-181]A Fresh Face Fuck Her Once, And You"ll Want To Fuck Her Again! These Natural Bodies Are So Amazingly Talented At Sex, Even An Adult Video Male Actor Will Forget That He"s On The Job! Her Adult Video Debut Rion Kanami

  • rion kanami censoredblowjobbeautiful girlMIFDmoodyzusapyonmoodyz freshMIFD-181MIFD181mifd00181
    • 2021-10-15
    147 min

    [PPPD-966]This Big Tits Little Stepsister Took Her Big Stepbrother"s Taunting Seriously, And Didn"t Realize That He Was Creampie Fucking Her During An Out-Of-Control Piston-Pounding Fuck Fest Karen Yuzuriha

  • karen kaede censoredcreampiebig titsPPPDoppaiPPPD-966PPPD966pppd00966
    • 2021-10-20
    53 min

    541AKYB-033 Hana (21) Such A Cute Girl! ？？ Gou Pubic Hair Girls Who Continue To The Buttocks! (Urara Kanon)

  • amateur censoredamateurbeautiful girlakybakyb-033akyb033541akyb-033
    • 2021-11-11
    118 min

    [JURA-044]First Time Shots Dear Wife, Once Again. Asako Kotoriyu

  • asako kotori censoredcreampiemarried womanJURAcenter villagesouthern earthjurakuJURA-044JURA044h-086jura00044
    • 2021-11-24
    122 min

    [MTALL-002]Teased And Edged Over And Over! This Devilish Slut Will Rim Your Anal Hole And Suckle Your Nipples To Fulfill Your Submissive Creampie Desires Ichika Matsumoto

  • amateur censoredcreampiebeautiful girlMTALLmateriallMTALL-002MTALL002
    • 2021-12-13
    50 min

    229SCUTE-1155 Rin (22) S-Cute Glasses Honor Student Blame 100 Ikenai Degree Etch (Rin Miyazaki)

  • amateur censoreduniformamateurscutescute-1155scute1155229scute-1155
    • 2021-12-18
    111 min

    [BBTU-027]Massaging Colossal K-Cup Tits To Complete Destruction, Screaming, And Insane Orgasm Koume Ena

  • ena koume censoredbig titssquirtingBBTUdogmatenunmy big titsBBTU-027BBTU027bbtu00027
    • 2021-12-18
    122 min

    [GMEM-053]ULTRA SWEET Akagai Bishoujo Senshi Breaking In Lewd Awakening Pleasure Training UH]H]

  • hikaru konno censoredsingle workGMEMavs collector sbaba za babbyavscollector s goldGMEM-053GMEM053gmem00053
    • 2021-12-31
    127 min

    [MIAA-553]「もう射精してるってばぁ！」状態でも追撃痴女してくるイジワル家庭教師 天音ゆい

  • amane yui censoredcreampiebeautiful girlMIAAmoodyzmichiru arashiyamaeveryone s porn starMIAA-553MIAA553miaa00553
    • 2022-01-13
    48 min

    520SSK-046 Yui

  • amateur censoredcreampieamateursskssk-046ssk046520ssk-046
    • 2022-01-13
    107 min

    [SPRD-1505]The Son Gives A Creampie To His Stepmom, Who Came From The Countryside To The City. Honoka Nakayama.

  • hoka nakayama censoredcreampiemature womanSPRDtakara eizokyuta tukumoaleddinSPRD-1505SPRD150518sprd01505



    • Jav Cherry, watch JAV streaming online japanese xxx