leg fetish other tall censored javcensored




FC2HZGDWAAAKBISSNIFSDSSDASDPPPDMEYDATIDGMEMKSBJSSISSDABHUNTBNNPJAUKSMARAAVSABLKBBAN

2019-11-20
120 min

[ARM-815]Garter Belt Wrapped Thighs x Thigh Fucking 3

  • ichinose love himari ogawa censoredslutARMaroma planningshigeo kadowakiaromaARM-815ARM815arm00815
    • 2019-11-15
    148 min

    [TIKP-039]A Beautiful Married Woman With An Incredibly Erotic Body - Iroha Maeda

  • maeda iroha censoredcreampiebig titsTIKPtikitiki.comerTIKP-039TIKP039tikp00039
    • 2019-11-03
    150 min

    [KTB-026]I've Got Pants Too! - Bukkake - OL Suits Club 15 - College Girl Intern Kanon-san Shows Off Her Favorite Miniskirt And A Sexy Pant Suit - Kanon Nakajou

  • nakajo canon censoredsingle workbukkakeKTBkahanshin tigers mousouzokukahanshin tigersKTB-026KTB026ktb00026
    • 2019-10-13
    138 min

    [TIKB-057]God Specs: I Gave Aphrodisiacs To A 180cm Slender-Legged Super-Stylish Gal And She Let Me Fuck Her Without A Rubber - Elle Sato

  • sato l censoredcreampiesingle workTIKBtikitiki.comerTIKB-057TIKB057tikb00057
    • 2019-09-09
    129 min

    [BAVC-002]Sexual Gratification Sumire Is Inviting Emotion With Her Plump Butt: Sumire Kurokawa

  • sumire kurokawa censoredsingle workBAVCbaltanspilma boyvictoriaBAVC-002BAVC002bavc00002
    • 2019-09-05
    157 min

    [SSNI-560]Total Domain Tall Girl Flashes Her Sexy Legs - A Nympho In Knee Highs Hotaru Nogi

  • nogi firefly censoredschoolgirlsingle workSSNIs1 no 1 stylegoemonSSNI-560SSNI560ssni00560
    • 2019-06-14
    129 min

    [XRW-706]Beautiful Legs Pantyhoseism 03 Yui Tomita

  • yu tomita censoredsingle workXRWreal worksreal real worksXRW-706XRW706172xrw00706
    • 2019-05-17
    181 min

    [ABP-858]Sex OK!？ The Underground Massage Parlor Everyone Is Talking About 09. Sex In A Small Booth. The Tall Woman And Her Beautiful Legs Will Definitely Turn You On. Riona Mana

  • mana rio censoredsingle workABPprestigemasaru pantherabsolutely perfectABP-858ABP858118abp00858
    • 2019-04-12
    135 min

    [XRW-668]Beautiful Legs And Pantyhose-Ism. Miori Ayaha

  • ayaba miori censoredsingle workXRWreal worksreal real worksXRW-668XRW668172xrw00668
    • 2019-03-30
    153 min

    [JUFE-036]A Voluptuous Woman In A Tight Business Suit! The Dirty Clothed Sex Of An Accomplished, Tall, Beautiful Office Lady Asahi Mizuno

  • mizuno chaoyang censoredbig titsuniformJUFEfitchJUFE-036JUFE036jufe00036
    • 2019-02-08
    108 min

    [ARM-738]Milking White Cum With Black Leather Pants, Extreme Footjobs

  • tsukushika ayaka muto censoredARMaroma planningaromaARM-738ARM738arm00738
    • 2019-01-27
    98 min

    [SKMS-003]The Sexy, Beautiful Legs Of A Tall Girl Around An Engorged Penis. Forcing Our Way Into The Home Of A Perverted Young Wife On A Walk And Fucking Her. Rin Hifumi

  • one thousand three bells censoredsingle workSKMSmercurysukima industriesSKMS-003SKMS003h-1133skms00003
    • 2019-01-26
    171 min

    [JUFE-019]I'm Having Follow-Up Sex And Pounding This Beautiful Babe Until She Spasms In Trembling Orgasmic Ecstasy And Breaks Down Into A Blubbering Mess Sumire Kurokawa

  • sumire kurokawa censoredsingle workJUFEfitchJUFE-019JUFE019jufe00019
    • 2018-11-27
    148 min

    [SKMS-001]Sexy, Beautiful Legs X 178cm Tall X Sweaty. The Lustful Scent Of A Dirty Wife. Yuno Kumamiya

  • yuno kumamiya censoredslutsingle workSKMSmercurysukima industriesSKMS-001SKMS001h-1133skms00001
    • 2018-09-02
    150 min

    [KTB-007]BUKKAKE! The Office Lady Business Suits Club 5 - Mari Is A Fresh Face Life Insurance Sales Lady Who Wears Business Suits To Work And Party Outfits To Her After-Work Dates - Mari Takasugi

  • mari takasugi censoredsingle workbukkakeKTBkahanshin tigers mousozokukahanshin tigerskahanshin tigers mousouzokuKTB-007KTB007ktb00007
    • 2018-02-04
    139 min

    [KTB-002]BUKKAKE! Office Ladies Suit Club - Saryu-san Tall Girl Beautiful Legs Suits Conservative Office Lady Clothes - Saryu Usui

  • sakisui censoredsingle workbukkakeKTBkahanshin tigers mousouzokukahanshin tigersKTB-002KTB002ktb00002
    • 2017-09-30
    119 min

    [BLK-331]A Tall Tanned Gal Standing 172cm Likes To Go Picking Up Old Men, Especially Tiny Ones ARIA

  • aria censoredcreampiesingle workBLKkira kirakira kira black galBLK-331BLK331blk00331
    • 2017-03-30
    162 min

    [IPZ-918]High Leg Swimsuit Race Queen Slut Who Won't Say No Himawari Yuzuki

  • sunflower sunflower censoredsingle workIPZidea pocketxavier thomasdishIPZ-918IPZ918ipz00918
    • 2017-03-11
    162 min

    [JUFD-716]Fully Clothed Fucking With Hard Working And Alluring Women Nao Wakana

  • nao wakana censoredbig titsslutJUFDfitchtaishiJUFD-716JUFD716jufd00716
    • 2017-03-03
    123 min

    [WSS-280]A Real Life College Girl Who Won The Grand Prize At A Famous College Beauty Pageant Loves Knockout Fucking!!! Riona Hashiguchi

  • riona hashiguchi censoredsquirtingdeepthroatWSSwaap entertainmentWSS-280WSS2802wss00280
    • 2017-02-11
    152 min

    [IPZ-894]Pit Babe In Leotards Wets Herself Runa Hinata

  • don t go censoredsquirtingsingle workIPZidea pocketxIPZ-894IPZ894ipz00894
    • 2015-11-26
    239 min

    [SDMU-277]SOD Female Employee 34th Truth Or Dare Within The Company But Remarkably Conspicuous Models 6 Tall, Beautiful Legged Girls I Want To Enjoy Their Long Limbs! I Want To Fawn Over Their Big Womanly Bodies! Between The Girls And The Smallish Us

  • censoredSDMUsod createhajime yarigasakisod female employeeSDMU-277SDMU2771sdmu00277
    • 2014-08-01
    121 min

    [SGA-010]A Slender Big Tits 9 Heads Tall Married Woman Aoi Matsushima, Age 31 In Her AV Debut

  • satoshi matsushima censoredbig titssingle workSGAprestigesamantha tabatasetsugetsukaSGA-010SGA010118sga00010
    • 2014-06-15
    109 min

    [DPMI-015]V.I.P AFTER Anju Kitagawa

  • anki kitagawa censoredsingle workDPMImiludopamixDPMI-015DPMI015dpmi00015
    • 2013-03-28
    140 min

    [ZUKO-025]Super Tall VS Super Short SPECIAL - Big Nasty Orgies With Tall Beauties Ren Aizawa Reira Aisaki Riko Miyase Ryo Yazawa

  • aizawa love rei aisaki chihiro hara censoredZUKOzukkon bakkontiger kosakaiZUKO-025ZUKO025zuko00025
    • 2013-02-07
    118 min

    [EBOD-263]181cm WILD BODY Yu Aso

  • aso yu censoredbig titssingle workEBODe bodyhao minamiEBOD-263EBOD263ebod00263
    • 2012-11-02
    133 min

    [KMI-071]Unreal Panty Hose Legs Masaki Aoyama

  • saki aoyama censoredsingle workKMImilukuroichiKMI-071KMI071kmi00071
    • 2012-10-07
    119 min

    [EBOD-232]Perfect E-BODY Exclusive Debut Manami Aoi

  • manami sakurai censoredbig titssingle workEBODe bodyhao minamiEBOD-232EBOD232ebod00232
    • 2012-09-07
    119 min

    [DPMI-008]High Heal Angel Lidia Asahina

  • asahina lydia censoredsingle workDPMImiludopamixDPMI-008DPMI008dpmi00008
    • 2012-06-11
    118 min

    [DPMI-007]Erotic Tights Ruka Ichinose

  • ichinose luka censoredsingle workDPMImiludopamixDPMI-007DPMI007dpmi00007



    • Jav Cherry, watch JAV streaming online japanese xxx