javcensored schoolgirl mini system censored small milk




FC2VENUHDKASDABNATRNACXROYDPPPDAWDGMEMCHRVPREDHMNNACRMIDVJULCESDHZGDBLKDASDSQTE

2021-01-08
61 min

Caribbeancom 010821-001 This is how I made my husband fall in love with me again Runa Hinata

  • runa hinata uncensoredcreampiehandjobcaribbeancom
    • 2021-01-08
    120 min

    [FSDSS-154]Beautiful Cop Addicted To Aphrodisiac Orgasms Suzume Mino

  • suzume mino censoredbig titssingle workFSDSSfalenoyamaguchi memberfaleno starFSDSS-154FSDSS1541fsdss00154
    • 2021-01-22
    65 min

    [ETQR-189][Daydream POV] Babymaking Raw Creampie Sex During A Colossal Titted Maid's Ovulation Day - Rika Aimi

  • rumi tadami censoredcreampieblowjobETQRerotic timeETQR-189ETQR189h-1186etqr00189
    • 2021-01-24
    119 min

    [BLOR-161]This Cute Thirty-Something Lady Works At A D**gstore And She Turned Out To Be A Soft And Gentle, Kansai-Dialect-Speaking Lady With Amazing Techniques Who Transformed Into A Serious Slut When I Fucked Her With My Big Cock!

  • censoredBLORbroccoli mousouzokubroccoliBLOR-161BLOR161blor00161
    • 2021-01-27
    57 min

    230OREC-675 Tsumugi

  • amateur censoredcreampieamateurorecorec-675orec675orec-675
    • 2021-01-28
    66 min

    200GANA-2427 Seriously Nampa, first shot. 1588 Succeeded in picking up a beautiful woman with beautiful legs who becomes 0 alert when drinking alcohol! If you slowly shorten the distance and kiss, your eyes will soften and accept, and just by touchin

  • amateur censoredbig titsamateurganagana-2427gana2427200gana-2427
    • 2021-01-30
    68 min

    326KNTR-002 [Cuckold Immediately NN Bulletin] A metamorphosis gal who is jealous and estrus cums many times with an actor Ji Po ☆ I am crazy with an unfaithful act begging for pregnancy juice! !!

  • amateur censoredcreampieamateurkntrkntr-002kntr002326kntr-002
    • 2021-01-30
    107 min

    [RD-1039]This Employee Is Getting Rock Hard For His Sexy Fifty-Something Lady Boss, And Now He's Gone Insane ... "Don't You Like Me？ I'm A 55-Year Old Lady, Is That Not Good Enough For You？"

  • madoka censoredmarried womanblowjobRDathena videomurayamaathenaRD-1039RD1039149rd01039
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    117 min

    [YAKO-023]Skinny Girl

  • censoredamateurbeautiful girlYAKOmercuryshinjuku undergroundYAKO-023YAKO023h-1133yako00023
    • 2021-02-18
    178 min

    [HUNBL-033]Barely Legal Girls Bound With Bike Locks

  • censoredcreampieschoolgirlHUNBLhuntergeminihhh groupHUNBL-033HUNBL033hunbl00033
    • 2021-03-01
    49 min

    FC2PPV 1706817 Remove the rubber without permission while inserting it into the slender JD. First round of vaginal cum shot without permission

  • amateur uncensoredfc2
    • 2021-03-03
    120 min

    [PFES-012]This Beautiful Office Lady Is Up Close And Unguardedly Luring You To Panty Shot Temptation Minami Aizawa

  • minami aizawa censoredslutsingle workPFESidea pocketichigoharasummer panties festivalPFES-012PFES012pfes00012
    • 2021-03-11
    158 min

    [MIST-329]Ovulation Day Special! This Delivery Maid Is Ready To Be Impregnated Erina Oka

  • hill erina censoredcosplayMISTmr michirusaitaMIST-329MIST3291mist00329
    • 2021-03-17
    62 min

    492MERC-280 Gal Who Wants To Be A Wife

  • amateur censoredcreampieuniformmercmerc-280merc280492merc-280
    • 2021-03-23
    60 min

    FC2PPV 1737660 4 months pregnant! !! , 21-year-old F-cup real pregnant woman’s vaginal cum shot support contract until childbirth Completely original 110th person

  • amateur uncensoredfc2
    • 2021-03-26
    141 min

    [MMND-196]"I Can't Do Porn" Yuno Homura 94cm I-Cup Plain Looking But Eager To Fuck 20 Years Old

  • homura yune censoredbig titssingle workMMNDmimanyuki iwasawaMMND-196MMND196mmnd00196
    • 2021-04-22
    67 min

    515BTGL-003 Mei (19)

  • amateur censoredcreampiebig titsbtglbtgl-003btgl003515btgl-003
    • 2021-04-22
    170 min

    [NHDTB-519]The Honor S*****t Who Barges In On Sexy Time In The Library Gets Fucked So Hard And Deep She Sheds Tears

  • censoredsquirtingschoolgirlNHDTBnatural highvanilla sakuraiNHDTB-519NHDTB5191nhdtb00519
    • 2021-05-16
    75 min

    300NTK-571 [Body No.1 I Want To Embrace] A Tokyo Girl Who Receives A Baptismal Raw Insertion In The City of Flowers! !! F milk that seems to be squeaky with a beautiful appearance with a chewy feeling and a round rubbing response that seems to be mat

  • pfsex censoredcreampiebig titsntkntk-571ntk571300ntk-571
    • 2021-05-20
    180 min

    [FUFU-200]When I Let My Serious Fifty-Something Wife Party With My Young Employee And Left Them Alone...180 Minutes

  • censoredamateurmature womanFUFUstar paradisefufuFUFU-200FUFU200h-254fufu00200
    • 2021-06-04
    64 min

    230OREC-782 Good

  • amateur censoredcreampieamateurorecorec-782orec782230orec-782
    • 2021-06-24
    64 min

    10musume 062421_01 A neat girl who cums is a bristle pussy Fumi Saito

  • amateur uncensored10musume
    • 2021-07-09
    149 min

    [IPX-688]Must-see Boys with Sensitive Nipples! Make-out Idol Nipple Treatment Anna Kami

  • anna kami censoredsluthandjobIPXidea pocketdishIPX-688IPX688ipx00688
    • 2021-07-24
    49 min

    [DANDAN-005]"I'm An Old Lady, But I Can't Control Myself Anymore ..." I Was At A Men's Massage Parlor That Didn't Allow Any Nookie, But This Sexy Therapist Kept On Luring Me To An Erectile State, So She Offered Me Several Con

  • censoredbig titshandjobDANDANdandytanaka baconDANDAN-005DANDAN0051dandan00005
    • 2021-08-02
    44 min

    326HGP-018 [Alps-Class Boobs Mountains] Transcendental H Cup! !! The Sensitivity Of The Girls With A Super Flesh-Like Plump Body Suddenly Rises Due To Drunkenness! A Lewd Busty Beauty Who Keeps Half Asleep And Cums Inside! !!

  • amateur censoredcreampieamateurhgphgp-018hgp018326hgp-018
    • 2021-08-19
    113 min

    [JURA-040]First Time Shots: Dear Wife, Again. Arisa Funaki

  • arisa funaki censoredcreampiemarried womanJURAcenter villagekotaro misatojurakuJURA-040JURA040h-086jura00040
    • 2021-08-29
    85 min

    229SCUTE-1119 Haruna (21) S-Cute Thighs Erotic Marshmallow Girls And Bargaining H

  • amateur censoredamateurbeautiful girlscutescute-1119scute1119229scute-1119
    • 2021-09-10
    146 min

    [NDRA-091]Keeping It A Secret From My Girlfriend, I Also Fuck Her Mom...Haruka Aizawa

  • haruka serizawa kotone kuroki censoredmature womanslutNDRAjet eizomanji groupNDRA-091NDRA091ndra00091
    • 2021-09-11
    163 min

    [URPW-053]A Free-For-All Fuck Fest With Our Favorite Big Tits Waitress! I Had All The Ejaculations And Creampie Sex I Could Ever Want With These 3 Divine Titty Babes Ruka Inaba Sarina Momonaga Mizuki Yayoi

  • inaba sarina momonaga censoredcreampiebig titsURPWunfinishedrolandoppainURPW-053URPW053urpw00053
    • 2021-09-17
    162 min

    [KRU-129]The Panty Shot Rhythm of Mature Women

  • censoredmature womanlingerieKRUkarumagroupKRU-129KRU129kru00129
    • 2021-09-24
    120 min

    [JUL-725]Rin, The Stepmom Of Two Good-for-nothing Sons, Is Used By Them To Process Their Libidos. Rin Okae

  • rin okae censoredmature womansingle workJULmadonnayo sukeJUL-725JUL725jul00725
    • 2021-10-09
    238 min

    [NASH-586]A Married Woman Betrays Her Husband "Dear, Please Forgive Me, I Just Wanted Some Excitement" Best Hits Collection 4 Hours

  • censoredcreampiemature womanNASHnadeshikoNASH-586NASH586nash00586
    • 2021-10-21
    202 min

    [SUN-033]Tropical Exhibitionist Deluxe - Golden Shower Girl Yuuri-chan D***ks Cum And Gets Creampied On Vacation

  • rena censoredsingle workSUNsuntanaka baconSUN-033SUN03313sun00033
    • 2021-10-21
    73 min

    FC2PPV 2355453 * Limited Price [Outflow] Dance Powerhouse, Dancer From Tokyo Metropolitan K High School, Muscular Physical Beauty, Unstoppable Hip Swing Cowgirl Sex Outflow [High Quality Dl Available]

  • amateur uncensoredfc2
    • 2021-10-29
    157 min

    [JUNY-048]The Ban is Lifted at Last! An Explosive Ass, A Big-Time Orgasm, The Pleasures of an Anal Fuck. Rio Ohara

  • osamu osamu censoredanalsingle workJUNYfitchnikuyokuJUNY-048JUNY048juny00048
    • 2021-11-10
    100 min

    546EROF-006 [Leaked] Model Private Gonzo Back Video (Yukine Amazawa)

  • amateur censoredcreampieamateureroferof-006erof006546erof-006
    • 2021-11-13
    120 min

    [GVH-320]Stepmother Fucks Her Stepson, Yukie Mizukami

  • yukie mizukami censoredcreampiemature womanGVHglory questkisakura kabinGVH-320GVH320gvh00320
    • 2021-11-19
    116 min

    [JUL-776]Gorgeous Housewife - Mayu Onodera Vol. 2! Her First Adulterous Drama! It All Starts With A Passionate Kiss...

  • mayu onodera censoredmature womansingle workJULmadonnamamezawa mametarouJUL-776JUL776jul00776
    • 2021-11-19
    175 min

    [HMN-073]Cutting Out From Club Activities and Having One"s First Date, First Creampie, and First Unprotected Creampie with a Guy. Hina Hanae

  • hanayo hina censoredcreampieuniformHMNhonnakamamezawa mametarouHMN-073HMN073hmn00073
    • 2021-11-20
    241 min

    [SUPA-599]-True Amateur Nakadashi - Amateur X Creampie = Priceless! The Ultimate BEST!

  • censoredcreampiebig titsSUPAskyu shirotok taroSUPA-599SUPA599supa00599
    • 2021-11-30
    56 min

    10musume 113021_01 I Was Allowed To Vaginal Cum Shot By A Net Cafe Refugee Who Came To City As Just Like Running Away From Home Saori Asakawa

  • amateur uncensored10musume
    • 2021-12-03
    240 min

    [CLUB-661]We Went Picking Up Girls And Took Home This Friendly Pair Of Girls We Met At An Izakaya. If We Quietly Have Sex, Will Their Tight-Legged Friends In The Next Room Get Horny And Let Us Fuck Them Too？ 29

  • censoredsquirtingCLUBhentai gentleman clubCLUB-661CLUB661club00661
    • 2021-12-10
    69 min

    FC2PPV 2504509 * Loli Big Breasts Revolution 2nd [National Treasure G Cup] Brush wholesale, fucking, middle 〇. I attacked the sneak peek and tried to squeeze the seeds

  • amateur uncensoredfc2
    • 2021-12-18
    94 min

    300MAAN-728 [A Simple Lori Girl Is Awakening Eros] [Negotiations To Show Ona From Walking In Asakusa In A Yukata] [Squirting With The First Masturbation In My Life! ？？ ] [Maximum Immorality In A Perfect Body] [Big Climax By Inserting A Big Dick In An

  • amateur censoredcreampiesquirtingmaanmaan-728maan728300maan-728
    • 2021-12-29
    55 min

    Pacopacomama 122921_579 Mature Woman Have A Fling With Sex Toy Wearing: Maki Who Got Into The Pleasure Of Remote Control Maki Koizumi

  • amateur uncensoredpacopacomama
    • 2021-12-31
    119 min

    [ADN-365]Instructor Ayako Came To The Judo Training Camp Deep In The Forest To Be A Special Advisor, Now We"re Giving Her Amazingly Vigorous Sex (Lol). Kana Kusakabe

  • kana kusakabe censoredbig titssingle workADNattackerskitorune kawaguchiotona no dramaADN-365ADN365adn00365
    • 2022-01-08
    163 min

    [SABA-743]Sharing A Hotel Room With My Coworker After We Went Out And Missed The Last Train... She Seemed So Unguarded, I Couldn"t Resist Her... vol. 015

  • censoredcreampieuniformSABAskyu shirototodoSABA-743SABA743saba00743
    • 2022-01-13
    117 min

    [GS-419]Getting Hard When My Step-cousin Comes Over To Play Suddenly And Has No Bra On To Cover Up Her Nipples! I Didn"t Know She Was So Mature Now, Her Body Has Gotten So Sexy And I Didn"t Even Know It, She"s Carefree With No Bra On To C

  • censoredGSsosoru x garconred ballGS-419GS4191gs00419
    • 2022-01-17
    75 min

    299EWDX-397 H Cup Big Tits Wife 25 Years Old Virgin-Kun Brush Down Raw Creampie (Riho Takahashi)

  • amateur censoredcreampiebig titsewdxewdx-397ewdx397299ewdx-397
    • 2022-01-21
    86 min

    [AIMS-024]Niki Iwata / An Amateur And Beautiful Girl

  • iwata niki censoredbeautiful girlsingle workAIMSmedia brandjelly beAIMS-024AIMS024h-1255aims00024
    • 2022-01-27
    192 min

    [NHDTB-621]Miniskirt S********l Perversion 2: Flipping Up Skirts And Doing Them From Behind!

  • censoredschoolgirlNHDTBnatural highvanilla sakuraiNHDTB-621NHDTB6211nhdtb00621
    • 2022-01-29
    124 min

    [PKPR-007]Fresh Face One Room Swallow Documentary: Cute And Comforting Half-Japanese Beauty Ran Ayase

  • ran ayase censoredcreampiebeautiful girlPKPRpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPR-007PKPR007pkpr00007
    • 2022-02-01
    131 min

    [GOJU-197]In Her Fifties, A Mature Woman, And Real. A Kind, Affectionate, And Beautiful Mature Woman Devotes Her Life To Service. Chikako-san (52)

  • censoredcreampieamateurGOJUfifty somethingGOJU-197GOJU197h-1165goju00197
    • 2022-02-11
    122 min

    [TPPN-219]Suck on the Beautiful Big Tits of H-cup Beautiful Big Tits Io Hayami! Know the True Pleasure and Climax with Solid Sweaty SEX!

  • hayami yorizakura censoredbig titsbeautiful girlTPPNteppanTPPN-219TPPN219tppn00219
    • 2022-02-11
    67 min

    259LUXU-1519 Luxury TV 1521 A Beautiful Woman With A Aesthetic Sense Who Wants To See Her Having Sex Is Here! The M Temperament That I Had Hidden In The Sticky Blame Is Stimulated And I Have An Ecstatic Expression, I Leave Myself To The Piston Of A P

  • amateur censoredbig titsamateurluxuluxu-1519luxu1519259luxu-1519



    • Jav Cherry, watch JAV streaming online japanese xxx