javcensored school uniform high vision jav censored




FC2SQTESANMIDVCAWDSPRDHNDSSNIPREDHZGDKSBJNGODMILKMEYDCHRVHMNVENUEBODROYDHUNTBVENX

2018-03-16
184 min

[DOCP-031]Plain, Sweet & Serious Childhood Friend Moves Away, Comes Back As Ultra Talented Pervert Sex Machine!

  • ayumi hebei aoi sato censoredcreampieslutDOCPprestigedoc premiumDOCP-031DOCP031118docp00031
    • 2018-03-16
    240 min

    [DVDMS-237]A Normal Boys And Girls Focus Group AV Fathers And Daughters Who Love Each Other Very Much Are Participating In These Adult Field Trips! When A Schoolgirl Daughter And Her Father Are Together In A Love Hotel, Will They Take The 100,000 Yen

  • censoredcreampieschoolgirlDVDMSdeep sgreenhouse effectDVDMS-237DVDMS237dvdms00237
    • 2018-03-16
    126 min

    [AP-528]Uniform-Cutting Molestation in a Cram School Elevator

  • censoredschoolgirlAPapache demandmasanoriAP-528AP528ap00528
    • 2018-03-09
    140 min

    [VRTM-333]One the Way Home After Swim Team, This Girl Is Still Wearing Her Bloomers Under Her School Uniform! When She Gets Home, Daddy Gets Hot And Horny For Her Navy Covered Ass And Slips Her Some Aphrodisiacs To Get Her Hot And Sweaty! When He Une

  • sakaegawa noa yuuri censoredschoolgirlVRTMv r producejiro tsubuyakiVRTM-333VRTM333h-910vrtm00333
    • 2018-03-08
    245 min

    [NHDTB-100]She Was On The Overnight Bus And Couldn't Squeal With Pleasure As She Was Being Fucked Into Orgasmic Ecstasy With Slow Piston Pumping Thrusts And Couldn't Stop Herself From Losing Her Mind In Creampie Heaven Schoolgirls Only A Cowg

  • censoredcreampieschoolgirlNHDTBnatural highjanken kotamaNHDTB-100NHDTB1001nhdtb00100
    • 2018-03-08
    129 min

    [SDDE-532]This Cute And Mischievous JK Will Control Your Masturbation For You "Metropolitan Masturbation Instructions From The School Of JOI"

  • censoredschoolgirlSDDEsod createaida yumenosenzSDDE-532SDDE5321sdde00532
    • 2018-03-04
    232 min

    [OYC-168]I Slipped Some Aphrodisiacs To A Girl I Met On Social Media, And Now She's Moaning And Groaning And Cumming Her Mind Out! I Met This Girl On Social Media Who Was Exposing Herself With Erotic Selfies So I Invited Her To An Offline Meetup,

  • censoredcreampieschoolgirlOYCmidnight snack.companyspace nyanjirohhh groupOYC-168OYC168oyc00168
    • 2018-03-04
    243 min

    [HUNTA-419]A 1 Hour Creampie Cuckold Time Limit Challenge! I Had 1 Hour To Creampie Her Before Her Boyfriend Came Back, So I Kept Fucking Her Over And Over Again! My Friend Uses My Place Like His Own Personal Hotel And Today, Like Everyday, He Brough

  • censoredcreampieschoolgirlHUNTAhunterkawajirihhh groupHUNTA-419HUNTA419hunta00419
    • 2018-03-01
    142 min

    [JUTN-004]Nationwide Runaway Barely Legal Confessions A Barely Legal Who Came From Matsudo And Is Now Waiting For A Miracle Yuzu Kitagawa

  • yuzu kitagawa censoredbeautiful girlsingle workJUTNjumpjump avJUTN-004JUTN004h-227jutn00004
    • 2018-03-01
    125 min

    [ZEX-345]Neat and Clean Beautiful Girl Spasms: Yoshika Futaba

  • rika futaba censoredbig titsbeautiful girlZEXpeters maxpresidentZEX-345ZEX345h-720zex00345
    • 2018-02-16
    240 min

    [GDHH-092]No Matter How Old She Gets, My Innocent Childhood Friend Likes To Play Pranks (Wrestling, Gas Pedaling My Balls, etc) On Me, And It Gets Really Rock Hard!!! Before I Knew It, She Was The Most Popular Girl In Class, And I Became A Wallflower

  • censoredschoolgirlGDHHgolden timerobby kunhhh groupGDHH-092GDHH092gdhh00092
    • 2018-02-16
    129 min

    [KTKL-027]The Popular Little Sister Cafe In Ikebukuro The No.1 And Most Popular Barely Legal We Negotiated For Some Secret Optional Services A Secret AV Debut

  • censoredcreampieschoolgirlKTKLkitixx mousouzokuloliconKTKL-027KTKL027ktkl00027
    • 2018-02-16
    244 min

    [HUNTA-412]My Childhood Friend Felt Sorry For Me, So She Decided To Let Me Practice Sex By Hot Dogging Me! And That's All It Was Supposed To Be! Me And My Childhood Friend Were Always Together Since We Were Little Kids, But Now She's Become A

  • censoredschoolgirlHUNTAhunterkawajirihhh groupHUNTA-412HUNTA412hunta00412
    • 2018-02-11
    135 min

    [APNS-045]These Two Are Best Friends... They Only Want The Best For Each Other, And Here Cums A Dirty Bastard Who Shits All Over Their Good Feelings... Aoi Mukai Nami Sekine

  • ai mukai nami sekine censoreddramaAPNSaurora project annexnasu yukihiroAPNS-045APNS045apns00045
    • 2018-02-10
    119 min

    [MIAE-182]Shining Thick Thighs Penetration Slender Knee High Beautiful Girl - Akari Mitani

  • mitani akari censoredsingle workMIAEmoodyzzampamoodyz acidMIAE-182MIAE182miae00182
    • 2018-02-09
    221 min

    [SCPX-251]My Childhood Friend Is A Virgin, And I'm A Cherry Boy We're So Sweet And Innocent, But Now We're Bashfully Practicing To Have Sex! I Was Grinding My Cock Against Her Pussy, But It Was So Wet And Dripping That It Just Slipped Rig

  • censoredcreampieschoolgirlSCPXscoopyosukemousouzokuSCPX-251SCPX251h-565scpx00251
    • 2018-02-09
    199 min

    [BAZX-115]"I Wanna Fuck This Girl..." VOL.009 I Couldn't Control My Hard On For This Neat And Clean Beautiful Girl In Uniform So I Had To Assault Her

  • censoredcreampieamateurBAZXmedia stationtodobazookaBAZX-115BAZX11561bazx00115
    • 2018-02-09
    121 min

    [SABA-377]# Creampie Raw Footage Runaway Beautiful Young Girl In Uniform 002 Kaede

  • censoredcreampieamateurSABAskyu shirototodoSABA-377SABA377h-244saba00377
    • 2018-02-02
    120 min

    [ONEZ-122]#Tokyo Raw Creampie Pussy Pounding Gal In Uniform Vol.002 Shino Saijo

  • saijo censoredcreampiebig titsONEZprestigeonezONEZ-122ONEZ122118onez00122
    • 2018-02-02
    121 min

    [DIC-006]Suzume No.3 Rina/Mai

  • censoredschoolgirlamateurDICdickyDIC-006DIC00636dic00006
    • 2018-02-02
    242 min

    [WSP-132]Fully Clothed Sex With A Beautiful Young Girl In Uniform

  • chika sakaegawa noa censoredschoolgirlWSPwaap entertainmentsWSP-132WSP1322wsp00132
    • 2018-02-01
    117 min

    [AMBI-087]The School Committee Chairperson Was Modest - Ai Hoshina

  • sena ai censoredcreampieuniformAMBIplanet plusbirdman teppeiAMBI-087AMBI087h-237ambi00087
    • 2018-01-28
    126 min

    [SQTE-200]Mikako Abe x S-Cute Natural Bodies Cute Sex

  • abe mikako censoredbeautiful girlsingle workSQTEs cuteSQTE-200SQTE200sqte00200
    • 2018-01-26
    483 min

    [TRE-062]Beautiful Young Girl in Uniform School Days Sex Special A Sexy And Bittersweet Virtual Experience With 18 Hot And Popular Student Babes

  • censoredbeautiful girlTREprestigetreasureTRE-062TRE062118tre00062
    • 2018-01-19
    130 min

    [DIV-244]J Slick Pussy Dildo Masturbation 8

  • kimiiro kanon ai rui censoredschoolgirlDIVoffice k sdont knowdiva sDIV-244DIV24436div00244
    • 2018-01-12
    120 min

    [MDTM-321]Raw Orgasmic Creampie Sex With A Shaved Pussy Girl With Massive Bovine Tits Since She Didn't Seem To Know Much About Protection, I Came Inside Her

  • censoredcreampiebig titsMDTMmedia stationuchu kikakuMDTM-321MDTM32161mdtm00321
    • 2018-01-11
    156 min

    [STAR-865]An SOD Star Ann MIta All Cum Face All The Time! A Massive Incest Family A Six Way Orgy She's Got A Fresh And Hot Body And Having Sex With The Family Until She Loses Her Mind!!

  • miharu kawada anri mita censoredschoolgirlsisterSTARsod createzampasod starSTAR-865STAR8651star00865
    • 2018-01-11
    225 min

    [NHDTB-078]A Big Tits Schoolgirl In Uniform Gets Groped And Grabbed From Behind And Wiggles Her Ass On A Crowded Bus By A Titty Grabbing Molester 3

  • censoredbig titsschoolgirlNHDTBnatural highjanken kotamaNHDTB-078NHDTB0781nhdtb00078
    • 2018-01-08
    130 min

    [APKH-054]Sticky And Dripping Humid Sex With A Girl In Uniform Under The Futon This Meat Eating Beautiful Girl With Fair Skin And Banging Beautiful Tits And Nasty Pussy Hair Is Getting Busy For Nookie Action Enjoy As She Descends Into Lusty Semen-Fil

  • hinata clan censoredcreampieschoolgirlAPKHaurora project annexaurora project anexAPKH-054APKH054apkh00054
    • 2018-01-05
    145 min

    [DOCP-011]I Couldn't Control The Thrill I Felt From The Total Domain Peeking Out From Underneath Her Miniskirt...

  • censoredamateurDOCPprestigedoc premiumDOCP-011DOCP011118docp00011
    • 2017-12-31
    244 min

    [HUNTA-391]Hunter x Apache x Golden Time Triple H Group A 3 Label Variety Collaboration These Girls Were Molested By A Molester On Their Way To School, And Right After Getting To Class They Erupted In Horny Lust! I Was The Only Boy At This Commercial

  • censoredschoolgirlHUNTAhunterkawajirihhh groupHUNTA-391HUNTA391hunta00391
    • 2017-12-23
    110 min

    [MUKD-440]A Divinely Small Waist And A Nice Round Ass

  • censoredcreampiebeautiful girlMUKDmukuMUKD-440MUKD440mukd00440
    • 2017-12-22
    72 min

    [ETQR-018]Creampie Raw Footage OK Sailor Uniform Beautiful Girl Reflexology -Ai Hoshina

  • censoredcreampieschoolgirlETQRerotic timeETQR-018ETQR018h-1186etqr00018
    • 2017-12-22
    120 min

    [XRW-414]A No Panty Topless Schoolgirl

  • censoredbig titsschoolgirlXRWreal worksreal real worksXRW-414XRW414172xrw00414
    • 2017-12-22
    200 min

    [BAZX-102]"I Want To Fuck This Girl..." VOL.007 When A Prim And Proper Private Schoolgirl Gets Defiled And Degraded Into A Sex-Addicted Horny Slut

  • censoredcreampieschoolgirlBAZXk m producetodoBAZX-102BAZX10261bazx00102
    • 2017-12-22
    151 min

    [MDTM-313]An Obedient Schoolgirl Who Wants To Be Toyed With By Men A Seriously Cute Beautiful Girl In Creampie Raw Footage Maya Hasegawa

  • maya hasegawa censoredcreampieschoolgirlMDTMk m produceani nakamuraMDTM-313MDTM31361mdtm00313
    • 2017-12-21
    129 min

    [IENE-845]Akari Mitani A Newly Wed Lifestyle Between A Teacher And Student

  • mitani akari censoredschoolgirlsingle workIENEie nergykiku rinIENE-845IENE8451iene00845
    • 2017-12-17
    243 min

    [HUNTA-389]Do Girls Drop Their Guard Underneath The Foot Warmer？ It Was Panty Shot Heaven! One Cold Day, My Little Sister Brought Her Friends Over They All Huddled Together In The Foot Warmer Doing Their Homework, And I Decided To Take A Peek. And I

  • censoredschoolgirlsisterHUNTAhunterkawajiriHUNTA-389HUNTA389hunta00389
    • 2017-12-09
    142 min

    [MRXD-071]A Perverted Maso Barely Legal Who's Hooked On Deep And Rich Sex With Dirty Old Men Please Teach Me How To Fuck I Want To Learn More, Much More Ai Hoshina

  • sena ai censoredbeautiful girlsingle workMRXDmarukusu kyoudaiarashiyama michiruMRXD-071MRXD071mrxd00071
    • 2017-12-09
    117 min

    [SSNI-068]A Devilish Little Sister Will Make Your Daydream Fantasies Cum True In A Sure Thing Erotic Situation Miharu Usa

  • miharu hanasaki censoredbig titsbeautiful girlSSNIs1 no 1 stylekyouseiSSNI-068SSNI068ssni00068
    • 2017-12-08
    123 min

    [FSTD-003]No Parents, No Husband An 18 Year Old H Cup Full Term Pregnant Girl, Sayaka She Looks Just Like *na *koma From No**zaka 46 And Now She's Appearing In This AV In Order To Pay For Her Childbirth

  • censoredcreampiebig titsFSTDfirst starupdatingFSTD-003FSTD003h-491fstd00003
    • 2017-12-08
    122 min

    [SABA-351]Creampie Embargo Lifted An Honor Student Who's Gotten A Taste Of After School Sex

  • censoredcreampieschoolgirlSABAs kyuu shiroutoupdatingSABA-351SABA351h-244saba00351
    • 2017-12-08
    140 min

    [MDS-879]Beautiful Class Representative's Erotic Creampie Miyu Amano

  • miyu amano censoredcreampiebig titsMDSk m producewiruchinchinMDS-879MDS87961mds00879
    • 2017-12-08
    120 min

    [SABA-352]"I Was Raped By Smelly Dirty Old Men..." This Young Shaved Pussy Honor Student Was Held Down And Forced To Accept Rock Hard Cocks Shoved Into Her Pussy Meet 3 Schoolgirl Babes Who Were Assaulted By The Out-Of-Control Libidos Of Roug

  • censoredsquirtingschoolgirlSABAskyu shirotoSABA-352SABA352h-244saba00352
    • 2017-12-07
    139 min

    [STAR-850]Masami Ichikawa Romantic Lovey Dovey Thrills Of Youth And Daydream School Cosplay Sex Fantasies

  • masami ichikawa censoredschoolgirlsingle workSTARsod createichinose kurumiSTAR-850STAR8501star00850
    • 2017-12-07
    162 min

    [MANE-010]A Total Maso Man Domination School Life An Ultra Sadistic Classmate Is Breaking In A Schoolboy To Transform Him Into Her Kind Of Maso Slave Noa Eikawa

  • sakaegawa noa censoredsingle workMANEakinorishurikenMANE-010MANE0101mane00010
    • 2017-12-03
    194 min

    [OYC-148]We Are Weak-Willed Girls And Don't Have The Courage To Turn Down Any Requests We Cannot Refuse Anyone, So We Obey Whatever These Motherfuckers Say And Are Forced Into Creampie Sex Over And Over Again And Of Course, We Haven't Been Ab

  • censoredschoolgirlOYCoyashoku.companymatildahhh groupOYC-148OYC148oyc00148
    • 2017-11-24
    125 min

    [MDTM-303]Little Black Cat Maya Will Repay Your Kindness (With Sex) Maya Misaki

  • maya misaki censoredcreampiesquirtingMDTMmedia stationjozu tokonomauchu kikakuMDTM-303MDTM30361mdtm00303
    • 2017-11-24
    239 min

    [HONB-041]Huge Gang Bang - Four Hours

  • censoredHONBmercurythe first shibuya special force headquarHONB-041HONB041h-1133honb00041
    • 2017-11-24
    118 min

    [MDTM-298]All New After School Beautiful Girl Rejuvenating Reflexology + Vol.006 Seiran Igarashi

  • seirang igarashi censoredcreampieuniformMDTMk m producetodoMDTM-298MDTM29861mdtm00298
    • 2017-11-23
    110 min

    [MUKD-436]A Tiny Titty Schoolgirl With A Small Waist Is Begging For A Backdoor Creampie Kanon

  • censoredcreampieschoolgirlMUKDmukuupdatingMUKD-436MUKD436mukd00436
    • 2017-11-23
    110 min

    [MUKD-437]This Schoolgirl Says, I Like the Cowgirl Position, And As Soon As She Slips His Cock In For A Cowgirl, She Starts Shaking Her Ass Like A Totally Different Person, And Keeps Cumming Over And Over In Cowgirl Creampie Ecstasy

  • censoredcreampieschoolgirlMUKDmukuupdatingMUKD-437MUKD437mukd00437
    • 2017-11-23
    147 min

    [MUDR-026]Please Fuck My Daughter A Father's Lust Is Fueled When He Watches His Beloved Daughter Get Fucked By His Boss Mio Oshima

  • mio oshima censoredcreampieschoolgirlMUDRmukuMUDR-026MUDR026mudr00026
    • 2017-11-21
    122 min

    [KTR-020]Private Date with a Slender Beauty in Uniform Mayu Sato

  • mayu saito censoredbeautiful girlsingle workKTRk tribeKTR-020KTR020h-094ktr00020
    • 2017-11-19
    150 min

    [APKH-051]A Beautiful Young Girl In Uniform And Cultural Club President Who Is Possessed With Daydream Fantasies Of Sex Yayoi Amane

  • amane yayoi censoredcreampieschoolgirlAPKHaurora project annexupdatingAPKH-051APKH051apkh00051
    • 2017-11-16
    160 min

    [MIST-186]A JK Infested Summer Vacation We're Unleashing Videos Of Girls Filming Each Other In Creampie Large Orgies!

  • azuki yurina aizawa censoredschoolgirlMISTmr michiruupdatingMIST-186MIST1861mist00186



    • Jav Cherry, watch JAV streaming online japanese xxx