javcensored jav uniform humiliation creampie




FC2AUKGMVSDMIDVGVHMEYDMIDEAWDDTTVEMANACRCJODHUNTBATIDSSISKSBJBLKHMNADNCESDDASD

2023-12-07
225 min

116NHDTB-852 Natural High Year-End Special: Molester OK Girl, Fully Naked Exposure Edition. Let The Beautiful Girl With Beautiful Skin And Big Breasts, Who Is Absolutely No Good, Be Allowed To Cum Inside With The Pleasure Of Outdoor Humiliation.

  • amateur censoredcreampiesquirtingnhdtbnhdtb-852nhdtb852116nhdtb-852
    • 2022-02-03
    115 min

    [MILK-135]They Went After Rena, The S********l, For Some Creampie Sex While She Rested. Rena Kodama

  • kodama rena censoredschoolgirlbeautiful girlMILKmilkMILK-135MILK135h-1240milk00135
    • 2022-01-28
    150 min

    [CAWD-332]Disciplining A Compliant Maid With A Pregnancy Fetish - Moko Sakura

  • sakura moko censoredcreampieuniformCAWDkawaiihiroyuki kimuraCAWD-332CAWD332cawd00332
    • 2022-01-28
    128 min

    [DFE-058]My Stepdaughter Provides For Me. Kurumi Iketani.

  • ikeya gurumi censoredcreampieuniformDFEwaap entertainmentnishiki sasafearlessDFE-058DFE0582dfe00058
    • 2021-12-24
    123 min

    [DFE-057]I Am Eating Up This Y********l. Rena Usami

  • reina usami censoredcreampieuniformDFEwaap entertainmentnishiki sasafearlessDFE-057DFE0572dfe00057
    • 2021-12-17
    123 min

    [FOCS-039]All I Wanted Was To Become An Idol ... I Deceived This Boyish Beautiful Girl And Pounded Her Pussy To Pieces!! A Squirting Sexual Experience Of Despair After Being Cornered Into An Unscrupulous Contract Nana Hayami

  • don t be quick censoredcreampiesquirtingFOCSabc mousouzokufocusFOCS-039FOCS039focs00039
    • 2021-08-21
    120 min

    [APNS-254]Group Fuck Cuckold Wife Braids And Uniform..."Until All Of You Are Satisfied, I"ll Do Anything For You In Front Of My Husband So Fuck Me All You Want" Ai Mukai

  • ai mukai censoredcreampiesingle workAPNSaurora project annexnasu yukihiroAPNS-254APNS254apns00254
    • 2021-07-30
    117 min

    [DFE-055]My Stepdaughter Supports Me. Nanami Yokomiya.

  • yokomiya nanami censoredcreampieuniformDFEwaap entertainmentsasanishikifearlessDFE-055DFE0552dfe00055
    • 2021-04-17
    133 min

    [DASD-854]Pretending To Be Seduced And Mercilessly Fucking! Devilish Teacher Ravishes The Moody S*****t President Nanase Asahina

  • asahina nanase censoredcreampieuniformDASDdaschinpo dazaiDASD-854DASD854dasd00854
    • 2021-04-09
    116 min

    [DASD-845]Intense Creampie Inteview My Teacher's Huge Dick And Cum Won't Fit In Me... Kanon Amane

  • natural kanon censoredcreampieuniformDASDdaschinpo dazaiDASD-845DASD845dasd00845
    • 2021-03-26
    130 min

    [GNAX-049]Sex Servant After School I Am A Sex Toy For My Classmates Noa Eikawa

  • sakaegawa noa censoredcreampieuniformGNAXnagirakazumaGNAX-049GNAX049h-1345gnax00049
    • 2021-02-21
    115 min

    [CAWD-178]My Neighbor Is A Dirty Old Man Who Lives In A Stinky, Smelly Apartment, And Now This Girl In A School Uniform Is Getting Pumped Full Of 46 Straight Creampie Cum Shots And Impregnated Like A Domesticated Bitch, And Finally ... Moko Sakura

  • sakura moko censoredcreampieuniformCAWDkawaiiCAWD-178CAWD178cawd00178
    • 2020-08-01
    151 min

    [ATID-435]Stepsister Training, Our New Stepdad Teases Us Every Night... Kanna Shirashi, Rei Kuruki

  • shiraishi plane satoshi kuruki censoredcreampieuniformATIDattackerskitorune kawaguchiin madATID-435ATID435atid00435
    • 2020-06-06
    146 min

    [AP-771]Opening The Door And Suddenly Irrumatio!! Thrusting Irrumatio 10 Girls! College Girl Edition

  • censoredcreampieschoolgirlAPapachenachiguronhhh groupAP-771AP771ap00771
    • 2020-06-06
    228 min

    [HUNTA-781]Our Trainee For Today Says "In The Future, I Want To Work In Customer Service" And "I Want To Make People Smile When I Serve Them Delicious Food" And We Understood That Her Goals Were To Work In The Food Industry...

  • censoredcreampieschoolgirlHUNTAhuntermorikihhh groupHUNTA-781HUNTA781hunta00781
    • 2020-06-06
    174 min

    [AP-773]Uniforms And Knee-High Socks In Hot Pursuit Of Sexy S********ls

  • censoredcreampieschoolgirlAPapachegeronimohhh groupAP-773AP773ap00773
    • 2020-05-09
    203 min

    [KRU-087]The Dash Cam Voyeur Videos Of Sex With A Beautiful Y********l In Uniform

  • censoredcreampieschoolgirlKRUkarmamanji groupKRU-087KRU087kru00087
    • 2020-05-02
    168 min

    [OYC-321]Timid Nurse Futon Up Close Rough Throat Fuck

  • censoredcreampieuniformOYCoyashoku.companygarumahhh groupOYC-321OYC321oyc00321
    • 2020-04-04
    232 min

    [AP-756]Female S*****t Fucked Twice In One Day S*********l Get's Gang Fucked By Store Employees As Payment For Shoplifting

  • censoredcreampieschoolgirlAPapachebarracudahhh groupAP-756AP756ap00756
    • 2020-04-04
    191 min

    [AP-757]A Big Tits Nurse This Slutty Nurse Is Getting Chased Around While Her Big Tits Are Hanging Out

  • censoredcreampiebig titsAPapachebarracudahhh groupAP-757AP757ap00757
    • 2020-03-05
    177 min

    [OYC-311]This Super Plain Jane Beautiful Maid Was Getting Relentless Attention Towards Her Nipples From The Manager For Days On End, Until One Day, She Began To Desire His Attention, As She Could Feel Her Nipples Throbbing With Lust...

  • censoredcreampiebig titsOYCoyashoku.companysleggerhhh groupOYC-311OYC311oyc00311
    • 2020-03-05
    235 min

    [AP-750]Creampie Counterattack On A High School Bully!

  • censoredcreampieschoolgirlAPapachebarracudahhh groupAP-750AP750ap00750
    • 2019-11-30
    203 min

    [AP-719]An Unassertive Woman Who Works For A Construction Company Gets Sexually Harassed By Her Coworkers And Made To Suck On Their Sweaty Cocks

  • censoredcreampieuniformAPapachemasanorihhh groupAP-719AP719ap00719
    • 2019-11-30
    150 min

    [AP-717]Nurse Is In On It So She Can't Run Away! Schoolgirl Sexual Harassment Health Exam Forced Nipple Cumming Molestation 2

  • censoredcreampieschoolgirlAPapachemasanorihhh groupAP-717AP717ap00717
    • 2019-11-30
    213 min

    [OYC-293]She Was Subjected To Relentless Nipple Tweaking, Day After Day Of Sexual Harassment, Until One Day, She Found Herself Expecting And Hoping For Sexual Harassment... And Now She Was Developing Her Nipples For A Lustful Awakening! 3

  • censoredcreampieuniformOYCoyashoku.companysleggerhhh groupOYC-293OYC293oyc00293
    • 2019-11-14
    235 min

    [AP-715]Schoolgirl "Total Domain" Prank Body Measurement

  • censoredcreampieschoolgirlAPapachebarracudahhh groupAP-715AP715ap00715
    • 2019-11-02
    156 min

    [AP-711]This Sch**lgirl In Glasses Was Caught A Sudden Rainstorm And Now Her Underwear Was Showing Through Her Wet Clothes, To The Delight Of This Molester

  • censoredcreampieschoolgirlAPapachebarracudahhh groupAP-711AP711ap00711
    • 2019-10-12
    205 min

    [AP-704]Sch**lgirl Babes A Sensual Nipples Tweaking Sexual Harassment Physical Examination

  • censoredcreampieschoolgirlAPapachebarracudahhh groupAP-704AP704ap00704
    • 2019-10-03
    216 min

    [OYC-279]A Weak-Willed Nurse Who Endures Dismal And Soul-Crushing Sexual Harassment On A Daily Basis, And Just Continues To Take It

  • censoredcreampieuniformOYCoyashoku.companymatildahhh groupOYC-279OYC279oyc00279
    • 2019-10-03
    159 min

    [AP-700]A Sch**lgirl Bully I Chased Her Around In An Abandoned Building And Got My Creampie Revenge!

  • censoredcreampieschoolgirlAPapachegeronimohhh groupAP-700AP700ap00700
    • 2019-09-05
    208 min

    [AP-688]Schoolgirls Violent Squirting G-Spot Orgasm Molester

  • censoredcreampieschoolgirlAPapachebarracudahhh groupAP-688AP688ap00688
    • 2019-08-16
    155 min

    [AP-686]A Beautiful Toilet Cleaner The Deep Throat Bukkake Molester

  • censoredcreampieuniformAPapachehhh groupAP-686AP686ap00686
    • 2019-08-03
    180 min

    [AP-680]Sch**lgirl An Alcohol-Soaked Tampon Forced Drunk Girl Orgasmic Hell

  • censoredcreampieschoolgirlAPapachebarucudahhh groupAP-680AP680ap00680
    • 2019-07-04
    195 min

    [OYC-262]"I Hate That Woman, So Go Ahead And Fuck Her" Dangerous Woman Sells A Woman She Hates To Men

  • censoredcreampieschoolgirlOYCdinner.companymachirudahhh groupOYC-262OYC262oyc00262
    • 2019-07-04
    120 min

    [AP-670]Hard Bang With Classmate In Hangout Spot, 193 Orgasms! 5000 Twitches!! Squirting 30,000 cc Molester

  • censoredcreampieschoolgirlAPapachekuniokahhh groupAP-670AP670ap00670
    • 2019-06-15
    240 min

    [AP-665]A Plain And Timid Girl Who Works At A Factory Can't Fight Back Even When She Gets Sexually Harassed. The Men Do What They Like With Her Day After Day, And No Matter How Many Times She Gets Creampied, She Just Wipes Herself With A Tissue W

  • censoredcreampieuniformAPapachenachiguronhhh groupAP-665AP665ap00665
    • 2019-06-15
    218 min

    [AP-666]Nurse Is In On It So She Can't Run Away! Schoolgirl Sexual Harassment Health Exam Forced Nipple Cumming Molestation

  • censoredcreampieschoolgirlAPapachemasanorihhh groupAP-666AP666ap00666
    • 2019-06-15
    238 min

    [OYC-259]Women Get Persistently Harassed Everyday And Starts Letting Her Body Give In...

  • censoredcreampieuniformOYCoyashoku.companyhhh groupOYC-259OYC259oyc00259
    • 2019-04-26
    240 min

    [OKAX-502]I Can Never Tell My Parents... The Truth Is, I'm Being Raped Every Day After School 3

  • censoredcreampieschoolgirlOKAXkm produceside dishesOKAX-502OKAX50284okax00502
    • 2019-04-13
    196 min

    [OYC-248]I Called For A Mobile Masseuse At A Hot Spring Inn While On A Business Trip And I Could See Her Underwear Under Her White Uniform! I Couldn't Control Myself And I Poked Her With My Rock Hard Dick. She Just Moaned Quietly And Weakly Said

  • censoredcreampieuniformOYCoyashoku.companymatildahhh groupOYC-248OYC248oyc00248
    • 2019-04-12
    150 min

    [MDS-889]When I Tried To Ruin Her Promising Future By Giving Her A Creampie She Started To Fight Back Frantically. She Looked So Endearing... Rape Destroys Her Wonderful Life In A Girls' Dormitory

  • arisaka miyuki hikaru minazuki censoredcreampiesquirtingMDSmedia stationjohnny shibuyauchu kikakuMDS-889MDS88961mds00889
    • 2019-04-04
    209 min

    [OYC-245]You Have 1 Minute To Think About It. The Ultimate 2 Choices! 1. You Can Stay Awake While I Fuck You 2. You Can Take A Sleeping Pill And By The Time You Wake Up, It Will All Be Over The Time Has Cum For Me To Get Revenge On This Girl That Had

  • censoredcreampieschoolgirlOYCoyashoku.companysleggerhhh groupOYC-245OYC245oyc00245
    • 2019-02-22
    240 min

    [OKAX-479]I Can Never Tell My Parents... The Truth Is, I'm Being Raped Every Day After School 2

  • censoredcreampieschoolgirlOKAXk m produceokazuOKAX-479OKAX47984okax00479
    • 2019-02-16
    162 min

    [AP-633]Super Sensitive! Premenstrual Schoolgirls. Nipple-Twisting Sexual Harassment During A Physical Exam. "Every Girl Gets A Creampie" Version

  • censoredcreampieschoolgirlAPapachekuniokahhh groupAP-633AP633ap00633
    • 2019-01-10
    242 min

    [RHE-637]"Why Is This Happening To Me..." She Was Young, And Then Her Life Was Finished A Naughty And Arrogant Schoolgirl Gets The Punishment Of Pleasure 13 Girls/4 Hours

  • censoredcreampieschoolgirlRHEhot entertainmentRHE-637RHE63759rhe00637
    • 2018-12-28
    239 min

    [OKAX-457]I Can Never Tell My Parents... The Truth Is, I'm Being Raped Every Day After School

  • censoredcreampieschoolgirlOKAXk m produceokazuOKAX-457OKAX45784okax00457
    • 2017-05-12
    134 min

    [GETS-041]This Hostess Princess At A Sexual Harassment Club Said, "I Can't Do This Anymore!" But We Kept Forcing Her To Drink And Harrassing Her Until...

  • censoredcreampieuniformGETSprestigeGETS-041GETS041118gets00041
    • 2017-02-24
    118 min

    [XRW-274]A Fresh Face Office Lady Moonlights As A Cum Bucket A Filthy Office Lady Gets Fucked To Shit By A Shady Corporation

  • mari rika hirose hirose censoredcreampieuniformXRWreal worksreal real worksXRW-274XRW274172xrw00274
    • 2016-02-21
    135 min

    [DMDG-027]Masochistic Tits Creampies Harura Mori

  • forest harura censoredcreampiebig titsDMDGgain corporationdont knowDMDG-027DMDG027dmdg00027
    • 2015-04-22
    207 min

    [ZRO-103]Uniform Creampie Rape. 11

  • censoredcreampieZROmadzeroZRO-103ZRO103h-286zro00103
    • 2014-05-29
    150 min

    [MIGD-590]Schoolgirl Gets Creampie & Gang Bang Suzu Ichinose

  • ichinose tin censoredcreampieschoolgirlMIGDmoodyznavemoodyz gatiMIGD-590MIGD590migd00590



    • Jav Cherry, watch JAV streaming online japanese xxx