javcensored jav censored schoolgirl devil




FC2NATRAUKSBLKCESDAMBIIPXADNWAAAMIAAABWMIDEWANZMVSDHDKANACRSHKDDASDSSISSPRDMEYD

2020-10-15
59 min

[EMOI-025]When Mao Watanabe (20) Finds A Partner For A Date With A Matching App

  • mao watanabe censoredamateurbeautiful girlEMOIsod createtiger kosakaiemotional girlEMOI-025EMOI0251emoi00025
    • 2020-10-25
    51 min

    330PER-331 Nagi 2

  • amateur censoredamateurcosplayperper-331per331330per-331
    • 2020-11-07
    44 min

    [lady-356]あん(24)

  • amateur censoredamateurblowjobladylady-356lady356lady-356
    • 2020-11-12
    129 min

    [MEKO-191]New 'Rent-A-MILF' Service 01 - These Housecleaners Are Known For Letting You Creampie Them, But We Try Asking For Something Even More Extreme

  • censoredcreampieamateurMEKOmilf laboMEKO-191MEKO191h-1160meko00191
    • 2020-11-17
    122 min

    [SDAB-152]Seed All The Way Down To Her Womb - The First Creampie Of Her Life. Ten Hasumi

  • hasumiten censoredcreampieschoolgirlSDABsod createtiger kosakaione s youthSDAB-152SDAB1521sdab00152
    • 2020-11-20
    56 min

    [oretd-798]ICHIKA

  • amateur censoredcreampieuniformoretdoretd-798oretd798oretd-798
    • 2020-12-03
    54 min

    C0930 ki201203 Mikiko Nakayama 37years old

  • amateur uncensoredc0930
    • 2021-01-03
    61 min

    Caribbeancom 010321-001 Beautiful sluts in kimono : threesome and 2 cum shots Ciel Hiiragi, Emi Sakurai

  • ciel hiiragi uncensoredcreampielesbiancaribbeancom
    • 2021-01-16
    141 min

    [YMDD-217]Reincarnated As A Sex Sleeve - Beautiful Get With Colossal Tits Continually Reborn As A Cum Dumpster Hana Himesaki

  • himesaki hana censoredcreampiebig titsYMDDmomotaro eizotommy boywakamomoYMDD-217YMDD217ymdd00217
    • 2021-01-16
    121 min

    [OKSN-315]I Polluted Our Love Nest

  • censoredblowjobOKSNabc mousouzokuokaasan.com abc daydream familyOKSN-315OKSN315oksn00315
    • 2021-01-29
    302 min

    [MKMP-377]Uta Yumemite Dream History [Legend]

  • yumemi teruuta censoredbeautiful girlsingle workMKMPk m producek taromillionMKMP-377MKMP37784mkmp00377
    • 2021-01-30
    120 min

    [JJDA-014]The Bride Rubs Her Father-in-law's Shoulders, And Her Father-in-law Rubs Her Breasts. Honota Tsujii

  • tsujii honoka censoredcreampiebig titsJJDAmature woman college real mature womanhirokoji osakimanji groupJJDA-014JJDA014jjda00014
    • 2021-02-04
    70 min

    435MFC-078 [Shiroto Gonzo] Almost a virgin (one experience) Gonzo with a slender female college student! !! / MIZUKI / 19 years old / B cup (small breasts)

  • mizuki censoredamateurcosplaymfcmfc-078mfc078435mfc-078
    • 2021-02-05
    139 min

    [HODV-21550][POV] Dialect Girl From Kyoto Kokomi Hoshinaka

  • kozomi hoshinaka censoredcreampiesingle workHODVh m pHODV-21550HODV215505642hodv21550
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    79 min

    [ZOZO-037]姫野かんな先生

  • censoredZOZOsadie willenauZOZO-037ZOZO0371zozo00037
    • 2021-02-22
    80 min

    259LUXU-1391 Luxury TV 1369 A beautiful woman with a strong libido who runs a lingerie shop has appeared! The greedy sexual desire that has accumulated in the pool collapses immediately by depositing it with an electric massage machine. In front of m

  • amateur censoredamateurluxuluxu-1391luxu1391259luxu-1391
    • 2021-02-28
    81 min

    428SUKE-063 [Impressed → Exciting Piston] Borrow a mobile battery and take a selfie with a beautiful girl and Pakopako SP! !! Go to the hotel from the aquarium date! “I want to be impatient with etch …” Insert it with a toy and insert

  • amateur censoredcreampieamateursukesuke-063suke063428suke-063
    • 2021-03-01
    48 min

    FC2PPV 1707347 [Personal shooting / Creampie] 33-year-old wife who wants to expose her proud body Thick semen released to the back of the body awakened by a toy

  • amateur uncensoredfc2
    • 2021-03-05
    74 min

    [LVID-010]Everyday Life Of A Sexy And Horny Step Daughter / Shizu-chan

  • censoredLVIDorustak softloveidolLVID-010LVID010
    • 2021-03-06
    239 min

    [TSP-439]Drilled By A Massive Dick Hammer! Female Foreman Gets Drilled! "You'll Catch A Cold If You Lay Down Here..."

  • censoredcreampieamateurTSPtokyo specialmanji groupTSP-439TSP439tsp00439
    • 2021-03-06
    222 min

    [HUNTA-961]I'm A Cherry Boy, And My Super Horny Big Stepsister And I Are A Cock-Match-Made-In-Heaven!？ I Suddenly Got A New Big Stepsister And She Turned Out To Be A Super Horny Slut Who Fucks Men With Abandon! And Until I Docked My Cock Into Her

  • censoredcreampiehandjobHUNTAhuntercognac kaminohhh groupHUNTA-961HUNTA961hunta00961
    • 2021-03-09
    44 min

    302GERK-356 Chie (22)

  • amateur censoredcreampieamateurgerkgerk-356gerk356302gerk-356
    • 2021-03-12
    68 min

    [orec-715]ちーちゃん

  • amateur censoredcreampieuniformorecorec-715orec715orec-715
    • 2021-03-20
    60 min

    C0930 ki210321 Mai Katagiri 26years old

  • amateur uncensoredc0930
    • 2021-03-24
    52 min

    444KING-030 Nanami (21)

  • amateur censoredcreampiebig titskingking-030king030444king-030
    • 2021-03-24
    104 min

    240TOKYO-425 Rie

  • amateur censoredbig titsamateurtokyotokyo-425tokyo425240tokyo-425
    • 2021-03-26
    118 min

    [MIDE-906]My Brother's Wife Always Looks Down On Me, But When I Found Out About Her Secret Part-Time Job As A Soapland Hooker, The Tables Were Turned! I Blackmailed Her Into Taking My Creampie Mizuki Aiga

  • mizuki ai censoredcreampiesingle workMIDEmoodyzhiroamoodyz divaMIDE-906MIDE906mide00906
    • 2021-03-27
    56 min

    230OREX-216 Ichika-chan

  • amateur censoredcreampieuniformorexorex-216orex216230orex-216
    • 2021-03-30
    108 min

    [RD-1048]A Filthy Showa Sensual Drama A Poor Mother With 3 K*ds Needed To Make More Money, So She Offered Up Her Body ... When The Landlord Paid Her A Night Visit, This Innocent Wife Wept And Thrashed Her Body With Dedicated Passion

  • yoko ikeda yu miyajima censoredmarried womanblowjobRDathena videomurayamaathenaRD-1048RD1048149rd01048
    • 2021-04-03
    170 min

    [SCPX-424]A Divine Nurse Who Treated Us Like Gods When I Unexpectedly Got An Erection, She Took Pity On Me, And Instead Of Admonishing Me, She Kindly And Gently Guided Me To Ejaculatory Pleasure And Sex

  • censoredbig titsuniformSCPXscoophasshimousouzokuSCPX-424SCPX424scpx00424
    • 2021-04-23
    46 min

    FC2PPV 1767772 [Personal shooting] Tomohame! I took a gonzo like a friend ☆ Moe 24 years old ☆

  • amateur uncensoredfc2
    • 2021-04-23
    119 min

    [MIAA-427]My Stepdaughter Told Me That She Was Worried About Being Too Slutty, But It Was All A Ruse To Get Me To Fuck Her - Panty Shot Temptation Leads To Had Pounding From Her Stepdad! Wan Horikita

  • horikita wan censoredcreampieblowjobMIAAmoodyzcaptain eharaeveryone s porn starMIAA-427MIAA427miaa00427
    • 2021-04-24
    51 min

    492JCHA-026 There is no reason why JK taken in erotic videos is naive!

  • amateur censoreduniformschoolgirljchajcha-026jcha026492jcha-026
    • 2021-05-07
    150 min

    [HODV-21572]Reika Hashimoto VS 3 Dicks

  • reika hashimoto censoredcreampiesquirtingHODVh m pHODV-21572HODV215725642hodv21572
    • 2021-05-18
    46 min

    396BIG-102 Ayaka

  • amateur censoredcreampieamateurbigbig-102big102396big-102
    • 2021-05-19
    240 min

    [OVG-171]Will I Get Into Trouble If Someone Sees Me？ 22 Horny Adult Video Actresses Who Enjoy The Thrill Of Potentially Getting Caught In The Act While Filming Themselves Engaging In Full Throttle Masturbation

  • censoredbig titsslutOVGglory questOVG-171OVG17113ovg00171
    • 2021-05-22
    242 min

    [NASH-507]Passionate Middle Aged Sex Older Men And Women Intertwine For Hot And Heavy Pleasure Fucking

  • momoko kikuchi kozue tokita censoredbig titsmature womanNASHnadeshikoNASH-507NASH507nash00507
    • 2021-05-29
    123 min

    [SQTE-370]Mikako Abe New Dismantling Book

  • abe mikako censoredcreampieblowjobSQTEs cuteSQTE-370SQTE370sqte00370
    • 2021-06-03
    177 min

    [SHIND-009]粘着ストーカーMの電車痴●・自宅侵入記録＃17・18

  • censoredcreampieamateurSHINDshinkirousuzuki o maSHIND-009SHIND009h-1560shind00009
    • 2021-06-19
    240 min

    [REXD-370]Peeping Priest - Voyeur Priest Catches A Widow Masturbating - Well, If She Wants It That Much...

  • censoredcreampieREXDredmanji groupREXD-370REXD370rexd00370
    • 2021-07-01
    68 min

    10musume 070121_01 Hired Young Escort Lady in a Swim Suit Keiko Eto

  • amateur uncensored10musume
    • 2021-07-04
    94 min

    300MAAN-671 [Demon Libido J ● Bitch x Super Class 4 Ejaculation] Super Beautiful Slender Body & Beautiful Small Butt God Erotic STYLE! Yariman girls who look and feel perfect ● Raw! Immerse yourself in the recently learned Feratech & nipple tor

  • amateur censoredcreampieamateurmaanmaan-671maan671300maan-671
    • 2021-07-08
    129 min

    [JRZE-060]First Time Filming My Affair Miyu Koizumi

  • yu koizumi censoredcreampiemature womanJRZEcenter villageminatoyashoku ureJRZE-060JRZE060h-086jrze00060
    • 2021-07-10
    127 min

    [KYMI-013]Pin-Up Slut

  • hamazaki mao suzuki mayu censoredslutKYMImiluaida yumenoKYMI-013KYMI013kymi00013
    • 2021-07-20
    25 min

    FC2PPV 1931459 [No] God Style ☆ G Cup !! Shinjuku Le 〇 〇 Shop Clerk Cum Shot In Rich Life (Part 2)

  • amateur uncensoredfc2
    • 2021-08-10
    122 min

    [KTRA-319]Obedient Stepsister Gets Creampied, Starring Tsumugi Narita

  • narita tsumugi censoredcreampieuniformKTRAke toraibuk tribeKTRA-319KTRA319h-094ktra00319
    • 2021-08-12
    127 min

    [SPRD-1444]Trying To Get Pregnant By My Father-In-Law And In Secret From My Husband, Violet Mihara

  • mihara sumire censoredmature womansingle workSPRDtakara eizouhotate ikkanaleddinSPRD-1444SPRD144418sprd01444
    • 2021-08-17
    62 min

    1Pondo 081721_001 Model Collection: Jessica Takizawa

  • amateur uncensored1pondo
    • 2021-09-03
    110 min

    [ADN-342]The Uncontrollable Passion Of My Wife Who Lost Her Feelings Of Pleasure, Michiru Kujo

  • kujo michiru censoredsingle workdramaADNattackersnagira kenzootona no dramaADN-342ADN342adn00342
    • 2021-09-10
    116 min

    [DASD-916]Gorgeous Stepmom And Step-daughter. Stepmom Meets Up With Step-daughter After Decades Apart. Minami Hatsukawa. Tsubaki Kato

  • hatsukawa minami kato camellia kaoru natsuki censoredcreampiemature womanDASDdaschinpo dazaiDASD-916DASD916dasd00916
    • 2021-09-11
    151 min

    [CHRV-139]A Medical Intern Step-Brother Who Wanted To Do "Palpations" That Involved Tit Fondling, Nipple Sucking, Finger Banging, And Sticking It In Raw Tempted By His Step-Sister"s Big Tits G-Cup 96Cm Mina

  • censoredcreampiebig titsCHRVcherries reboCHRV-139CHRV139chrv00139
    • 2021-09-20
    63 min

    SIRO-4635 [First Shot] [Slender Beauty] [Innocent Sweetheart] Discover A Shy And Sweet Sensitive Girl Who Fully Brings Out A Neat Feeling. The Innocent Slender Body As It Is Done Repeatedly Reacts To The Caress Of The Actor Relentlessly, And The Body

  • amateur censoredamateursirosiro-4635siro4635siro-4635
    • 2021-10-15
    150 min

    [BLK-532]She"ll Eat Men Up As She Bares Her Super Carnivorous Sexual Instinct To Prey On Cocks! Let"s Cum With Queen Maria! An Orgasmic Banging Date Maria Nagai

  • maria nagai censoredcreampiebig titsBLKkira kiratorendei yamaguchikira hosi kira black galBLK-532BLK532blk00532
    • 2021-10-21
    93 min

    [OKS-122]Erina Oka: Wet And Shiny, A Perfect Fit For A Godly Swimsuit! Enjoy These Cute Girls In Swimsuits! This AV Starts With A Voyeur Scene Of Big And Small Breasted Girls Changing Clothes And Turns To Close-up Fetishes Including Shaved Pussy, Sid

  • hill erina censoredschoolgirlbeautiful girlOKSoyaji no kosatsukami sukumizuOKS-122OKS1221oks00122
    • 2021-10-29
    134 min

    [VEO-048]Genuine Amateur Wife AV Debut! Neat and Clean Music College Graduate Wife Still Developing Her Dirty Body...Comes Again and Again Without Needing Blowing of a Whistle. Chiho Kawanishi

  • chiho kawanishi censoredcreampiemature womanVEOvenussarubornVEO-048VEO048veo00048



    • Jav Cherry, watch JAV streaming online japanese xxx