javcensored high visio hot spring creampie censored




FC2RBDATIDPPPDDASDJULKBICAWDDTTVENUCESDCHRVVEMAFSDSSSHKDMEYDSTARSSQTEROYDNNPJDASD

2020-12-05
147 min

[ADN-280]The Cuckolding Massage That Captures A Married Woman - Hikari Ninomiya

  • hikari ninomiya censoredsingle workdramaADNattackersbungo maedaotona no dramaADN-280ADN280adn00280
    • 2020-12-07
    41 min

    [ore-733]ミサト 2

  • amateur censoredcreampiebig titsoreore-733ore733ore-733
    • 2020-12-08
    82 min

    300NTK-469 Visit the hospital to find out what the cause and effect of 170cm beauty G milk OL is! !! The iron plate that I was born with is a raw spit! !! Even a dirty metamorphosis practitioner forgets the preciousness of loving beautiful limbs! !!

  • amateur censoredbig titsamateurntkntk-469ntk469300ntk-469
    • 2020-12-11
    120 min

    [SUPA-555]The Real Face Of A Married Woman - Yuka-san, 26 Years Old

  • censoredcreampiebig titsSUPAskyu shirotojohnny shibuyaSUPA-555SUPA555h-244supa00555
    • 2020-12-16
    91 min

    [opcyn-132]みつは 3(23)

  • amateur censoredcreampieamateuropcynopcyn-132opcyn132opcyn-132
    • 2020-12-28
    485 min

    [HMVX-006]Curvy Amateur With Big Tits - Sexy, Sweaty, Busty Babes - 480 Minutes

  • censoredcreampiebig titsHMVXhamedori.network secondeditionHMVX-006HMVX006h-1472hmvx00006
    • 2021-01-01
    176 min

    [ABW-040]Blue Spring 3 Totally POV Youthful Fucks With A Beautiful Y********l In Uniform #01 4 Youthful Graffiti Editions, Filled With Sex And Bittersweet Memories For You To Experience Through Your Own Eyes 175 Minutes Airi Suzumura

  • suzumura airi censoredcosplaysingle workABWprestigeshiko tissue fuwafuwaabsolutely wonderfulABW-040ABW040118abw00040
    • 2021-01-01
    67 min

    476MLA-016 The finest material with outstanding sensitivity found in the daddy activity app ☆ Unauthorized vaginal cum shot to a metamorphosis beauty college student who is obscenely swelling with the pleasure of old man Ji ○ port! !!

  • amateur censoredcreampieamateurmlamla-016mla016476mla-016
    • 2021-01-21
    104 min

    [MILK-102]She Hated This Middle Aged Dirty Old Man, But When He Relentlessly Tweaked Her Nipples, She Unexpectedly Found Herself Super Excited She Totally Fell For His Deeply Experienced And Relentlessly Amazing Techniques A Massively Orgasmic Sch**l

  • haruna kawai censoredcreampieschoolgirlMILKmilkMILK-102MILK102h-1240milk00102
    • 2021-01-22
    59 min

    [orex-196]もなちゃん

  • amateur censoredcreampieschoolgirlorexorex-196orex196orex-196
    • 2021-01-27
    101 min

    348NTR-027

  • amateur censoredcreampieamateurntrntr-027ntr027348ntr-027
    • 2021-02-10
    45 min

    FC2PPV 1680601 ☆ First shot ☆ Complete appearance ☆ Fair-skinned plump G body obedient G cup beautiful girl who looks good with shortcuts is the first Gonzo and cum shot ♥ [With benefits]

  • amateur uncensoredfc2
    • 2021-02-11
    63 min

    10musume 021121_01 Gonzo innocent busty beauty who is pistoned and cums UCHIUMIRYOKO

  • amateur uncensored10musume
    • 2021-04-14
    165 min

    [DVDMS-657]The MILF Housecleaner To Came To My Place Had Such A Fine Ass That I Couldn't Resist It - I Ground Up On Her And She Gave Me A Quickie! 10 "I've Got A Husband..." She Protested, But I Wouldn't Back Down, And In The End

  • censoredamateurDVDMSdeep sswing nagaseDVDMS-657DVDMS657dvdms00657
    • 2021-04-15
    247 min

    [NATR-656]Totally! Chie Nakamura

  • tomoe nakamura censoredcreampiebig titsNATRpinknadeshikoNATR-656NATR656natr00656
    • 2021-04-24
    51 min

    492JCHA-026 There is no reason why JK taken in erotic videos is naive!

  • amateur censoreduniformschoolgirljchajcha-026jcha026492jcha-026
    • 2021-05-07
    117 min

    [HBAD-582]A Dirty Wife Who Uses Her Body, Her White Skin And Her Beautiful Tits As Part Of Her Bewitching Charm - Honoka Tsujii

  • tsujii honoka censoredbdsmsingle workHBADhibinonamitaro umababeHBAD-582HBAD5821hbad00582
    • 2021-05-18
    140 min

    [MSFH-059]Wet And Slippy Climax Sex With A Shy Girl With A Relaxing Aura Who Finally Let Loose Fuwari Hino

  • hino fluffy censoredbig titssquirtingMSFHsod createkyoseims sodMSFH-059MSFH0591msfh00059
    • 2021-06-12
    119 min

    [NASH-523]Congrats On Her 60th Birthday! The Bubble Economy, The Recession, The Tsunami... Mature Cougar Born In 1961 Has Survived The Ups And Downs Of Life... And Now She's Horny

  • censoredmature womanNASHnadeshikoNASH-523NASH523nash00523
    • 2021-06-14
    66 min

    SIRO-4556 Application Amateur, First AV Shooting 215 [First Shooting] [Sensitive Immediately Iki Nurse] [Plenty of Salvation Service] An angel in a white coat that is sure to be very popular with patients has arrived. Frustration is too sensitive, cu

  • amateur censoredamateursirosiro-4556siro4556siro-4556
    • 2021-06-20
    243 min

    [NASH-526]部下に奪われた最愛の妻 全7話

  • ichika kamihata maria serizawa censoredmature womanNASHnadeshikoNASH-526NASH526nash00526
    • 2021-07-07
    108 min

    459TEN-022 [Queen Nakaiki] Assault on the home of an Ecup dental hygienist captured in Shinjuku! !! Bombshell fuck with special game underwear! !! "Ochi ● I feel really good !!!" "Isn’t it good !？" "I’m happy to be str

  • ecup censoredcreampiebig titstenten-022ten022459ten-022
    • 2021-07-10
    116 min

    [NSFS-007]Mature Stepmother 12 ~ The Stepson Who Loved His Stepmother ~ Yuri Tadokoro

  • yuri tadokoro censoredmature womanmomNSFSnagae stylejotaro tomiNSFS-007NSFS007nsfs00007
    • 2021-07-10
    121 min

    [CEMD-032]Two Mature Women Making Each Other Cum! Next to Them, Yet Another Mature Women Couple Make Each Other Cum! The Pinnacle of Nonstop Mature Women Lesbian Sex!

  • good miki ryoko izawa miki yoshii viewing moon bookmark censoredlesbianmature womanCEMDceleb no tomoCEMD-032CEMD032cemd00032
    • 2021-07-17
    55 min

    1Pondo 071721_001 Seducing by Flashing Pussy: Rena

  • amateur uncensored1pondo
    • 2021-07-22
    122 min

    [FSDSS-263]A Cherry For Some Lip Service A Cherry Boy Gets A Victorious Cherry Popping Yui Shirasaka

  • yui shirasaka censoredbeautiful girlsingle workFSDSSfalenoboomer 44faleno starFSDSS-263FSDSS2631fsdss00263
    • 2021-07-27
    78 min

    498DDH-026 Bring A High-Grade Tall Beautiful College Student Who Can Be Mistaken For A Model To The Room! Flirtatious SEX Where You Can Enjoy The Heavy And Massive Big Breasts Of Takamine’S Flowers Who Are Tipsy And In A Good Mood! ＃ 001

  • amateur censoredcreampiebig titsddhddh-026ddh026498ddh-026
    • 2021-08-05
    155 min

    [AKDL-129]「もう一回出そうよ◆」 何度もヌキたがる射精粘着の女子社員 美島由紀

  • yuki mishima censoredAKDLaquinoriaquinoriaknrAKDL-129AKDL1291akdl00129
    • 2021-08-07
    119 min

    [AUKG-519]The Lesbian Rejuvenation Massage Parlor 3 - Testing Out A Strap-On Dildo In Hidden Camera Footage -

  • otsu alice yuri yamaguchi censoredlesbianAUKGu kAUKG-519AUKG519aukg00519
    • 2021-08-20
    187 min

    [CJOD-307]Suite Room For Slutting It Up, Super Sadist Hot Sisters Call Me To A Hotel And Tie Me Up! Sandwich Me! Make Me Immobile! In 24 Hour Back To Back Cumshot Fucking... Minami Hatsukawa Kurea Hasumi Mitsuki Nagisa

  • hatsukawa minami hasumi claire censoredcreampieslutCJODbimasaki naochijo hebunCJOD-307CJOD307cjod00307
    • 2021-08-22
    40 min

    FC2PPV 2060301 [Amateur ❤ Creampie] It Was Said That It Would Be Best If You Had A Raw Fuck With A Married Woman In A Sauna & Open-Air Bath ❤ 18th Work [Sauna & Open-Air Bath]

  • amateur uncensoredfc2
    • 2021-08-26
    131 min

    [SPRD-1449]Journey: Just A Mother And Her Stepson - Aoi Yurika

  • yurika censoredmature womanmomSPRDtakara eizoumishima rokusaburoaleddinSPRD-1449SPRD144918sprd01449
    • 2021-08-30
    41 min

    292MY-474 Misa Koide 2

  • amateur censoredcreampiebig titsmymy-474my474292my-474
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-10-02
    77 min

    533NNS-019 Explosion H Cup P Live Girl! !! Unauthorized Mass Vaginal Cum Shot To A Big Tits De M Daughter Who Works At A Famous Hotel! !!

  • amateur censoredcreampiebig titsnnsnns-019nns019533nns-019
    • 2021-10-15
    119 min

    [MEYD-707]Goro Tameike A 15th Anniversary Year Collaboration No.9 The Big Tits Married Woman From Next Door Seemed Like A Plain Jane But One Day, She Accidentally Walked In On Me While I Was In The Middle Of Masturbation. She Didn"t Look It, But

  • reina taoyuan censoredcreampiebig titsMEYDtameike goroshouten shirouMEYD-707MEYD707meyd00707
    • 2021-10-17
    50 min

    FC2PPV 2352538 October Limited 1480 [Nothing] Slender And Beautiful Gal Wife Who Lives In The Housing Complex. She Was Late For Repayment And She Took Her To A Public Toilet And Forcibly Took A Continuous Vaginal Cum Shot.

  • amateur uncensoredfc2
    • 2021-10-29
    119 min

    [WAAA-111]Amazing Cunnilingus MANIAX, Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiesquirtingWAAAwanz factoryWAAA-111WAAA111waaa00111
    • 2021-11-02
    61 min

    188HINT-0488 Minako

  • amateur censoredmarried womanamateurhinthint-0488hint0488188hint-0488
    • 2021-11-06
    24 min

    FC2PPV 2409461 Limited To 100 [Uncensored] Sensitive Blonde Gal X Black Hair F Cup Halloween With Cosplay Girls And Mischievous Night 4p Creampie

  • amateur uncensoredfc2
    • 2021-11-12
    121 min

    [FOCS-034]Ultra-Cute Girl In Uniform...Blackened Dreams And Innocence. Taken Advantage Of And Torn Apart by Adults After Being Tricked. Aoi Nakajo

  • nakagusuku censoredbeautiful girldeepthroatFOCSabc mousou zokufocusFOCS-034FOCS034focs00034
    • 2021-11-13
    85 min

    355OPCYN-196 Yuuri (Yuri Asada)

  • amateur censoredcreampiesquirtingopcynopcyn-196opcyn196355opcyn-196
    • 2021-12-03
    121 min

    [JJDA-024]A Kind And Gentle Big Tits Wife Is Letting A Hard-Working Fully Erect Cherry Boy S*****t Fuck Her Behind Her Husband"s Back Nene Tanaka

  • nene tanaka censoredcreampiebig titsJJDAjukujo daigaku jukujo manjigroupJJDA-024JJDA024jjda00024
    • 2021-12-05
    37 min

    FC2PPV 2487946 Big Breasts Real Estate Sales Ol After Mischief By Train Creampie At The Hotel * Open Special Special Price Until 7th

  • amateur uncensoredfc2
    • 2021-12-10
    146 min

    [SSIS-257]Is She Luring Me To Temptation With Her Titties, Right Here!？ If We Get Caught, It"s Over, But Even Though We Can"t Make A Sound, My Girlfriend"s Older Sister Slut Keeps On Tempting Me With Her Big Tits And Rubbing Me With Immor

  • saki okuda censoredbig titsblowjobSSISs1 no 1 stylerokusaburo mishimaSSIS-257SSIS257ssis00257
    • 2021-12-20
    32 min

    FC2PPV 2530476 Limited Number! !! [Uncensored] Fcup The Secret Sexual Desire Of A Neat And Clean Beauty … Creampie In A Nasty Body That Is Disturbed Many Times! !!

  • amateur uncensoredfc2
    • 2022-01-03
    87 min

    SMUK-090 Hitomi (Hitomi Hoshitani)

  • amateur censoredcreampieuniformsmuksmuk-090smuk090smuk-090
    • 2022-01-05
    66 min

    274DHT-0373 Married Women Who Have Been Creampied On The Way Back From The Alumni Association ＃ 02

  • amateur censoredcreampiebig titsdhtdht-0373dht0373274dht-0373
    • 2022-01-08
    71 min

    H0930 tk0050 Shiho Harada 35years old

  • amateur uncensoredh0930
    • 2022-01-13
    130 min

    [MEKO-223]"Rental MILF" Service Returns 11 - If You Ask Nicely They"ll Let You Secretly Creampie Them - Sexy, Kindly Cougars Who Just Wanna Fuck And Cum Back For More

  • censoredcreampieamateurMEKOmature woman laboMEKO-223MEKO223h-1160meko00223
    • 2022-01-14
    115 min

    [MIAA-561]Lewd Overtime Work Late At Night With An Amazing Female Boss That Used To Party Hard. If You Make Results At Work You Get A Creampie As A Reward. Right Away His Cock Head Was Getting Teased Into Male Squirting That Makes It Last Endlessly W

  • mizukawa violet censoredcreampieslutMIAAmoodyztakarase hironoriminna no kikatanMIAA-561MIAA561miaa00561
    • 2022-01-14
    119 min

    [MIAA-570]Broke And Modest Big Tits Classmate Works Part-time Using Her Busty Chest, When The Lust Is Too Much To Bear She Opens Up For Full-on Fucking In Secret! After That, There"s A Reverse Threesome Creampie Competition Outside Of Work. Riho

  • riho takahashi suwon miso censoredcreampiebig titsMIAAmoodyzrakudaeveryone s porn starMIAA-570MIAA570miaa00570
    • 2022-01-14
    64 min

    498DDH-062 [When I First Tried A Business Trip Men’s Beauty Treatment Salon …] A Young Girl (H Cup) Came And Was Surprised. If You Touch Such A Child, You Will Be Embarrassed And Excited! Is The Sympathy Strong？ Miss Este Is Also Uplifting

  • amateur censoredcreampiebig titsddhddh-062ddh062498ddh-062
    • 2022-01-17
    40 min

    HTUT-512 Haruna (Haruna Kawakita)

  • amateur censoredcreampiebig titshtuthtut-512htut512htut-512
    • 2022-01-22
    120 min

    [SGM-053]Slippery Mature Woman Lesbian Pleasure Eating Intense And Thick Homosexual Moist Copulation Chisato Shoda , Yu Kawakami

  • shota chisato yu kawakami morino morino censoredbig titslesbianSGMglobal media entertainmentkikujiro akabanesuper global mediaSGM-053SGM053sgm00053
    • 2022-01-27
    66 min

    200GANA-2622 In The Spear Room Of The Nampa Master Of 100 Battles, Bring In Sex Hidden Shooting 233 Big Breasts With A Cute Smile … I Mean, Huge Breasts! Apparently It’s A J Cup … As Soon As You Flirt In Bed, It Becomes An Erotic Atmos

  • amateur censoredbig titsamateurganagana-2622gana2622200gana-2622



    • Jav Cherry, watch JAV streaming online japanese xxx