javcensored def schoolgirl censored over hours




FC2BBANEBODADNGVHIPXDASDSHKDCESDMILKWAAASPRDSSNIMIDVHDKANATRWANZHMNMIAANACRHZGD

2020-10-02
51 min

468NRPK-006 Asuka (20)

  • amateur censoredamateurbeautiful girlnrpknrpk-006nrpk006468nrpk-006
    • 2020-10-03
    113 min

    [RBD-991]Black Dick A Special Investigator Code Name Alpha She's Working To Solve The Mystery Of The Synthetic Aphrodisiac Called "Campamine" Yuri Honma

  • really censoredsingle workRBDattackerseitaro hagaeryupakuRBD-991RBD991rbd00991
    • 2020-10-09
    185 min

    [BAZX-253]Career Receptionist Dirty-Girl's Carnal Welcome vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-253BAZX253h-1496bazx00253
    • 2020-10-10
    61 min

    HEYZO 2371 Get Laid With A Pretty Flat-chested Beauty At Premium Soapland – Miyuki Sakura

  • miyuki sakura uncensoredcreampiehandjobheyzo
    • 2020-11-10
    59 min

    HEYZO 2394 Naked Housewife’s Lewd Private Life Vol.3 – Chino Ogata

  • chino ogata uncensoredcreampieheyzo
    • 2020-11-20
    79 min

    [THNIB-066]The Story Of An Innocent Girl - 5' Tall 19-Year-Old, F-Cup/Misuzu Amaki

  • censoredbig titsbeautiful girlTHNIBintec incTHNIB-066THNIB066h-706thnib00066
    • 2020-12-01
    272 min

    [C-2593]Full Edition: The Married Woman Sayako Series Secret Travel Encounters Of A Wife, Mother, And More...

  • censoredmarried womanCgo goesgogo s coreC-2593C2593140c02593
    • 2020-12-10
    41 min

    230OREC-656 Waka

  • amateur censoredbig titsamateurorecorec-656orec656orec-656
    • 2020-12-12
    118 min

    [IPX-581]Apparently, My Wife Is Cheating. Momo Sakura

  • sakura sky momo censoredbig titsblowjobIPXidea pocketkyoseidishIPX-581IPX581ipx00581
    • 2020-12-18
    28 min

    [BTH-101]I Want To Cum On This Girl's Face Asahi Mizuno

  • mizuno chaoyang censoredbig titsblowjobBTHchobitchchovicBTH-101BTH101h-1435bth00101
    • 2020-12-19
    38 min

    [HHKL-078]"Hey, What Do You Think About This Underwear？ Does It Look Cute On Me？" My Plain Jane Big Stepsister Started Working For An Underwear Company, And As She Began To Start Wearing Sexy Underwear, She Gradually Became More Sexy And Erot

  • nene tanaka censoredcreampiebig titsHHKLhunterkonjac kanohhh groupHHKL-078HHKL078hhkl00078
    • 2020-12-23
    48 min

    FC2PPV 1617526 [Personal shooting] 18-year-old neat and clean beautiful girl ④. Creampie in the vagina at the sports festival bloomers ♡ Seeding competition between boyfriend and uncle Enko ♡ “Please make me pregnant with Enko O-nchin … ♡&#

  • amateur uncensoredfc2
    • 2020-12-25
    216 min

    [SKMJ-137]College Girl Amateurs Clean Filthy Cocks With Their Own Holes! With The Tip Lovingly Scrubbed By The Back Door This Huge Cock Is Shoved Into Her Dripping Pussy For The Rinse Cycle! Then All The Way To Her Womb For Some Hard Pounding Creampi

  • censoredcreampieamateurSKMJred face girlone topSKMJ-137SKMJ137h-1324skmj00137
    • 2020-12-29
    87 min

    [MBRBA-069]朝倉沙月 キックボクサーでファッションモデルもこなす美女 デビュー

  • censoredMBRBAspice visualMBRBA-069MBRBA0695050mbrba00069
    • 2020-12-29
    97 min

    451HHH-015 AV first experience [Pant voice and Toro face] [Constant estrus] [Sloppy upper and lower mouths] Beautiful girl with fair skin and nice Shioume boobs and legs! It’s a way of speaking like a fluffy mystery, but the contents are just a

  • amateur censoredcreampiesquirtinghhhhhh-015hhh015451hhh-015
    • 2020-12-31
    151 min

    [JUL-428]Cheating Underwear Model - Shocking Footage Of Her Infidelity Caught On Camera - Married Slut Takes Her Cameraman's Creampie Kana Mito

  • kana mito censoredcreampiemature womanJULmadonnacaptain orionJUL-428JUL428jul00428
    • 2021-01-01
    790 min

    [LONG-020](For Streaming Editions) A Super Turn Of Events Underneath The Foot Warmer A Beautiful Girl Has Her Guard Down And Is Ready For Deep And Rich Sex!! Super Long-Length 13 Hours!!

  • censoredcreampieamateurLONGprestigelongshotLONG-020LONG020118long00020
    • 2021-01-01
    135 min

    [URKK-035]10 Orgasms Minimum!! Big Tits Magic Massage Salon Where You Can Cum Inside Her As Many Times As You Want While Her Big Tits Shake As She Has Orgasm After Orgasm - Hikari Sena

  • hikari sena censoredcreampiebig titsURKKunfinishedwild sevenone milk of soulURKK-035URKK035urkk00035
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-02-05
    58 min

    328HMDN-334 [Oni cock x married woman] 30-year-old university clerk’s married woman Misaki (pseudonym) The only thing that is quiet is her appearance and her pussy gets wet! Personal shooting with a lewd woman who loves sex Seeding convulsions p

  • amateur censoredcreampiebig titshmdnhmdn-334hmdn334328hmdn-334
    • 2021-02-09
    31 min

    S-Cute 814_wan_02 H who devours a fair-skinned girl who feels up to the neck / Wan

  • amateur censoredamateurwanwan-02wan02814-wan-02
    • 2021-02-10
    74 min

    [opcyn-149]すず(20)

  • amateur censoredamateurbeautiful girlopcynopcyn-149opcyn149opcyn-149
    • 2021-02-12
    147 min

    [EBOD-805]It's Been 10 Months Since Her Graduation... A Year Ago She Was A S*****t-Athlete! The National Freestyle Champion! Long-Limbed G-Cup Swimmer Ria Sarashina, Age 18, Makes Her E-BODY Debut!

  • ria sarashina censoredbig titsuniformEBODe bodymon cEBOD-805EBOD805ebod00805
    • 2021-02-22
    36 min

    FC2PPV 1697756 [No] ♯ Fair-skinned ex-girlfriend on a slope. I cooked a vaginal cum shot of ex-girlfriend with flirting on the bed.

  • amateur uncensoredfc2
    • 2021-02-27
    62 min

    200GANA-2438 In the spear room of the Nampa teacher of 100 battles, bring in SEX hidden shooting 191 Bring your cute erotic sister to the spear room and enjoy sweet sex like a lover! Carefully caress and supple body, quivering and feeling!

  • amateur censoredamateurganagana-2438gana2438200gana-2438
    • 2021-03-03
    134 min

    [GVH-201]Mamasita Real Stories - Toko Namiki

  • namiki touko censoredbig titsmomGVHglory questhyonGVH-201GVH20113gvh00201
    • 2021-03-11
    199 min

    [PIYO-107]"Stubborn Women Can't Resist Having Their Asses Fucked!" Rude Y********l Cries Out In Pleasure As I Fuck Her Up The Ass

  • censoredanalschoolgirlPIYOhyokopiero dagrey wolfPIYO-107PIYO1071piyo00107
    • 2021-03-12
    42 min

    FC2PPV 1723507 <Squirting instructor> [Obvious glossy body strike] Fithch sensual body that loves semen has begged for vaginal cum shot on LINE, so I injected plenty into the back of the vagina.

  • amateur uncensoredfc2
    • 2021-03-13
    114 min

    [APNS-232]I Was Subjected To Breaking In Training While My Little Stepbrother Watched ... I Was Degraded Into A Maso Bitch ... Aoi Mukai

  • ai mukai censoredcreampieblowjobAPNSaurora project annexyukihiro nasuaurora project anexAPNS-232APNS232apns00232
    • 2021-03-13
    151 min

    [MIDE-898]Tricked Into Servicing Her Awful Boss On A Weekend Hot Spring Trip, Cumming So Hard She Could Die... Sakura Miura

  • minamata sakura censoredbig titssingle workMIDEmoodyzbacon tanakamoodyz divaMIDE-898MIDE898mide00898
    • 2021-03-19
    140 min

    [TIKB-104]Masochistic Drooling Cum Faces! Super Sexy Married Woman Leaks Pussy Juice Wile Her Big Tits Bounce!

  • censoredcreampiebig titsTIKBtikitiki.comerTIKB-104TIKB104tikb00104
    • 2021-04-01
    122 min

    [AKDL-099]Married Sluts In Pantyhose With Hot Asses Fired Up For Quickies & Stealth Creampies - Horny Bitches Beg For Cum From Men They've Never Met Before!

  • yuka saeki karen otoha censoredcreampiebig titsAKDLaquinoristickaknrAKDL-099AKDL0991akdl00099
    • 2021-04-02
    131 min

    [HODV-21562]Only For Me! Training The Slutty Big Titty Runaway Girl Who Came To My House To Become My Perfect Sex Partner Tomoko Kamisaka

  • tomoko kamisaka censoredcreampiebig titsHODVh m pbottomsHODV-21562HODV215625642hodv21562
    • 2021-04-02
    236 min

    [HUNTA-984]"Please...Let Me Put It In Just A Little!" The Worst...No, Best Woman Ever Finally Let Me Fuck Her After Asking Over And Over

  • censoredblowjobHUNTAhuntermorikihhh groupHUNTA-984HUNTA984hunta00984
    • 2021-04-08
    108 min

    [SPRD-1396]Forgive Me... I Want My Son-In-Law So Get Me Pregnant - Honoka Nakayama

  • hoka nakayama censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1396SPRD139618sprd01396
    • 2021-04-24
    42 min

    [OSST-009]We Discovered This Wild And Tanned Gal In South Korea, So We Tried To Domesticate Her With Our Japanese Dicks! We're Soiling Her Tanned Body With Loads And Loads Of Our Semen!

  • censoredbig titsamateurOSSTpatzkin amateurbooker tulchan amateurOSST-009OSST009h-1450osst00009
    • 2021-04-27
    61 min

    499NDH-014 [Gal signboard girl in Shinjuku underground bar. ] Perfect body underground bar gal clerk persuaded and cum shot SEX! Although it looks flashy, the contents are clever and the gap difference is erotic! Spread your proud legs and poke them

  • amateur censoredcreampieamateurndhndh-014ndh014499ndh-014
    • 2021-04-27
    80 min

    300NTK-560 Beautiful Big Tits High Speed JD Advent Festival! !! Induced raw SEX with F’s soft skin binkan milk! !! High potential nasty technique is passed away with a continuous explosive combo and squeezing sexual intercourse can not end with

  • fjdsex censoredcreampiebig titsntkntk-560ntk560300ntk-560
    • 2021-05-13
    62 min

    515BTGL-004 Kaho

  • amateur censoredcreampiebig titsbtglbtgl-004btgl004515btgl-004
    • 2021-05-14
    140 min

    [YMDS-030]Hot And Steamy Deep Kissing At Home Lovey Dovey Sex The Day Hisui Matsumiya Became My Girlfriend

  • hisui matsumiya censoredcreampieblowjobYMDSmomotaro eizowakamomoYMDS-030YMDS030ymds00030
    • 2021-05-15
    54 min

    10musume 051521_01 7 month Naughty Prego Wife Wants to Get Fucked by Another Man Hiroko Ookubo

  • amateur uncensored10musume
    • 2021-05-21
    152 min

    [JUL-580]Flawless Big Booty Brides Madonna Exclusive Part 3! This Married Woman Joined Our Company Mid-Career And Her Beautiful Legs And Hot Ass In Pantyhose Have Lit My Lust On Fire... Risa Hoshizaki

  • lisa hoshisaki censoredmature womansingle workJULmadonnamametaro mamezawaJUL-580JUL580jul00580
    • 2021-06-04
    145 min

    [BBAN-327]Nanase Asahina Lesbian Release First Time Lesbian Experience With Beloved Eimi Fukuda!

  • asahina nanase emi fukada censoredlesbianbeautiful girlBBANbibianBBAN-327BBAN327bban00327
    • 2021-06-11
    117 min

    [DASD-871]I Woke Up In A Girl's Body And What My Best Friend Wanted, So My Heart Became That Of A Girl As Well. Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiesingle workDASDdasrokusaburo mishimaDASD-871DASD871dasd00871
    • 2021-06-27
    47 min

    FC2PPV 1891491 [Individual shooting 43] Appearance 20 years old Black hair neat and clean streak pie bread Cleaning blowjob from continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2021-07-18
    180 min

    [EYS-067]Hidden SEX Shooting With One Of My Mom's Friends Who Likes To Take Care Of Me vol. 4

  • censoredbig titsblowjobEYSstudio i sEYS-067EYS067eys00067
    • 2021-07-20
    180 min

    [KAZK-064]Fooling His Stepmother And Letting His Friend, A Massage Therapist, Give Her A Sexual Massage...180 Minutes

  • censoredmomKAZKstar paradisefamilyKAZK-064KAZK064h-254kazk00064
    • 2021-07-24
    49 min

    [DANDAN-005]"I'm An Old Lady, But I Can't Control Myself Anymore ..." I Was At A Men's Massage Parlor That Didn't Allow Any Nookie, But This Sexy Therapist Kept On Luring Me To An Erectile State, So She Offered Me Several Con

  • censoredbig titshandjobDANDANdandytanaka baconDANDAN-005DANDAN0051dandan00005
    • 2021-08-25
    86 min

    348NTR-034 Get A Cutie With Big Pie G Milk! I Think That There Is Something Wrong With It. In Fact, She Is His Cheating Partner! My Boyfriend Has A Favorite, So He Wants To Break Up With This Girl … She Doesn’T Know Such A Thing, And She De

  • amateur censoredcreampiebig titsntrntr-034ntr034348ntr-034
    • 2021-09-03
    141 min

    [HODV-21607](All POV) Rural Girls With Accents: Shizuoka Dialect Rin Kagura

  • kagura rin censoredcreampiesingle workHODVh m pHODV-21607HODV216075642hodv21607
    • 2021-09-06
    59 min

    FC2PPV 2164638 9/10 Made * 2980⇒1280pt: Since The Loss Of Virginity !! 19 Years Old X D Cup Active Jd Kosuzu ♥ "I Will Bother You" Ubu Daughter With Almost Zero Knowledge & Experience That Has Never Been Grasped By Matomo

  • amateur uncensoredfc2
    • 2021-09-26
    61 min

    413INST-167 (Extremely Rare Video) Big Tits Amateur 4P Raw Gonzo! The Cock Without Rubber Is Inserted In The Soaked Pussy Of Girls Who Are Greedy For Sex. Innocent Girls

  • amateur censoredcreampiebig titsinstinst-167inst167413inst-167
    • 2021-09-28
    58 min

    C0930 ki210928 Maya Yasuhara 22years old

  • amateur uncensoredc0930
    • 2021-10-02
    120 min

    [TKD-041]I Lost My Virginity To A Lusty MILF Tsubaki Kato

  • kato camellia kaoru natsuki censoredsingle workTKDrubytsuji koujiteikokuTKD-041TKD041tkd00041
    • 2021-10-08
    79 min

    300NTK-643 [W Beauty Bitch Summit Decisive Battle! !! Slender Vs Boyne’s W Bitch Dream Competition Gangbang! !! ] Supreme Vs Ultimate! !! Dochashiko Smashing Orgy 4p! !! Slender Gals And Rocket Milk Gals Of Course W Bitches! !! Betting The Pride

  • amateur censoredcreampieamateurntkntk-643ntk643300ntk-643
    • 2021-10-23
    149 min

    [NSFS-035]With That Annoying Person... -Wife Stolen, Both Body And Heart- Mami Nagase

  • asami nagase censoredsingle workdramaNSFSnagae styletomitake taroNSFS-035NSFS035nsfs00035



    • Jav Cherry, watch JAV streaming online japanese xxx