javcensored censored nampa creampie female college student




FC2KBIPREDWANZSSNICHRVABWHUNTBFSDSSMILKDASDPPPDSHKDDASDNATRAWDAPODHDKAGMEMVEMAMVSD

2020-12-10
239 min

[FZR-077]"My Husband's Cock Doesn't Satisfy Me..." The Slut Hall Of Fame! Horny Monster Nymphos: Totally Naughty Wives! File 002

  • censoredcreampiemarried womanFZRpacotterFZR-077FZR0773fzr00077
    • 2020-12-15
    56 min

    FC2PPV 1590472 [Personal shooting] Shaved beauty busty slender beautiful wife Maimi’s raw squirrel mass cum shot!

  • amateur uncensoredfc2
    • 2020-12-18
    245 min

    [TUS-091]A 120 Real Legend Of Seduction Vol.91 We're Injecting These Kyoto Beauties With Our DNA, Inside Their Pussies And Orally!!

  • censoredcreampiebig titsTUSprestigefishermanTUS-091TUS091118tus00091
    • 2020-12-18
    115 min

    [HZGD-172]NTR My Neighbor Lured My Husband To Temptation And Fucked Him... This Horny Bitch Slut Wife Used Her Light Skin And Beautiful Big Tits To Toy With All Of The Men In The Village And Lure Them To Creampie Sex Hina Nanami

  • hina nanami hina nanase censoredcreampiebig titsHZGDmarried woman flower garden theaterhirokoji osakiimage married woman flower garden theatHZGD-172HZGD172h-1100hzgd00172
    • 2020-12-25
    110 min

    [GNAX-041]New Break-in/Sara Kanami

  • kagami sara censoredcreampiedeepthroatGNAXnagiranagira kenzoGNAX-041GNAX041h-1345gnax00041
    • 2020-12-31
    200 min

    [HUNTA-918]The Most Popular Booth At This Private Girls' High School Festival, "The Quickie," Offers Refreshments To A Long Line Of Customers. Just What Could Be Inside？!

  • censoredcreampieschoolgirlHUNTAhuntermasanorihhh groupHUNTA-918HUNTA918hunta00918
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-20
    115 min

    [EMOI-045]Creampie POV / Her First Time Swallowing Cum In A Blowjob / First Time Showing Her Face With No Makeup / Frank 1-to-1 Talk / Beach Date In Shonan / Mao Watanabe (20)

  • mao watanabe censoredcreampieEMOIsod createtanaka baconemo girlEMOI-045EMOI0451emoi00045
    • 2021-01-21
    151 min

    Caribbeancom 012121-001 Loli Girl Anthology Mihono, Mao Sena, Wakaba Onoue, Riko Tabe, Nagisa

  • mihono mao uncensoredcreampiehandjobcaribbeancom
    • 2021-01-24
    135 min

    [DBER-096]The Lusty Beast Hunting Club Anal Sex Goes Viral - An Alluringly Beautiful Girl Cums To Hell - Part 7: This Sheltered Young Lady Got Anal Fucked And She Spasmed In Shame Until She Came In Ecstasy Mirei Nitta

  • mirei nitta censoredanalschoolgirlDBERbabyentertainmentkikubonred babeDBER-096DBER096dber00096
    • 2021-02-04
    98 min

    [FUGA-046]Unforgettable Loving Sex With My Mother's Friend - Misako Kiyohara

  • kiyohara misako censoredcreampiemature womanFUGAcenter villagemitsusato koutarourakuen center villageFUGA-046FUGA046h-086fuga00046
    • 2021-02-06
    200 min

    [DVDMS-627]First French Kisses In The One-Way Mirror Cab - Married Woman Melts With Tongues Entwined And Agrees To A Creampie! Her Neglected Pussy Heats Up For A Young Stud's Hot Smothering Kisses! The Thrill And Excitement Of At-Home Adultery, C

  • censoredcreampieamateurDVDMSdeep sfunky hasegawaDVDMS-627DVDMS627dvdms00627
    • 2021-02-11
    187 min

    [NHDTB-491]2 Holes Creampie Group Sex Bus

  • censoredanalcreampieNHDTBnatural highjanken kotamaNHDTB-491NHDTB4911nhdtb00491
    • 2021-02-13
    68 min

    275OCHA-082 U66

  • amateur censoredamateurbeautiful girlochaocha-082ocha082275ocha-082
    • 2021-02-19
    235 min

    [SIM-110]I'm Here To Offer My Little Stepsister For Sale She Was Filmed While Having NTR Creampie Sex With Her Big Stepsister's Boyfriend, And Now We're Selling The Footage Without Permission. Things Got Out Of Control And They Even Did S

  • censoredcreampiebig titsSIMprestigeshirotomanmanSIM-110SIM110118sim00110
    • 2021-02-26
    92 min

    SNYZ-020 Aria-chan 2

  • amateur censoredamateurcosplaysnyzsnyz-020snyz020snyz-020
    • 2021-02-28
    58 min

    FC2PPV 1704935 Yurika 19 years old A beautiful girl job hunting student who looks like an idol! E-cup beauty big breasts in a slender body when you take off your suit! Creampie with seeds on a beautiful girl who is shy and withdrawn!

  • amateur uncensoredfc2
    • 2021-03-13
    118 min

    [BAHP-069]STRAWBERRY PUSSY WATANABE MAO Mao Watanabe

  • mao watanabe censoredcreampiebeautiful girlBAHPbaltandaibutsu yoshidahoppinBAHP-069BAHP069bahp00069
    • 2021-03-14
    63 min

    SIRO-4441 [First shot] [Simple x neat x original] [Expected pants stain] A 21-year-old younger sister professional student who has a desire for protection. She sticks out a big ass disproportionately to her simple face and makes a cry to her hard roo

  • amateur censoredamateursirosiro-4441siro4441siro-4441
    • 2021-03-24
    84 min

    428SUKE-066 [Frustrated Gal = Continuous Exciting Squirting] Only Squirting Gal Wins! !! Even a gal who loves boyfriend is dissatisfied with his boyfriend! ？？ Excited about the big dick of a sex expert! Erotic flood w neck strangling vaginal cum shot

  • amateur censoredcreampiesquirtingsukesuke-066suke066428suke-066
    • 2021-03-25
    122 min

    [GS-380]On Location With The Cutest Female Director In The Industry. She Showed Up In A Miniskirt And See-Through Panties, Just Like Everyone Said! Of Course, As The Assistant Director, I Got Rock Hard.

  • censoreddramaGSsosoru x garconspada ikebukuroGS-380GS3801gs00380
    • 2021-03-26
    118 min

    [CLUB-634]I Fell In Love With A Cheerful Slut And Seduced Her By Pretending I Was A Virgin. She Couldn't Help But Want To Break In A Sweet, Shy Boy Like Me And The Moment My Cock Met Her Big Tits She Fell In Love With My Erection. Part Two.

  • censoredbig titsuniformCLUBhentai shinshi clubCLUB-634CLUB634club00634
    • 2021-03-28
    61 min

    230OREX-253 Rika

  • amateur censoredcreampiebig titsorexorex-253orex253230orex-253
    • 2021-04-04
    62 min

    413INST-110 Prefectural Commercial Enu-chan 1 ● Years Old ☆ Slender E Cup Real J ☆ Daddy Activity Loss Uncle’s Trapped Big Butt Girl Is Not Forgiving Until Begging For Creampie Lotion Bukkake Pakopako Piston ♪ Surrender J ☆ Manko Nidopyu Dopyu C

  • amateur censoredcreampiebig titsinstinst-110inst110413inst-110
    • 2021-04-15
    240 min

    [NASH-492]Guys And Girls Fired Up For Passionate Fucks - Tongues Entwined Intimately While They Mate 4 Hour BEST Collection

  • censoredcreampiemarried womanNASHpinknadeshikoNASH-492NASH492nash00492
    • 2021-04-18
    140 min

    [DBER-108]Seductress Domination Episode 9 - She's Used To Being Treated Like A Queen, But Now Her Sensitive Young Body Is Ready To Be Ravished Mitsuki Nagisa

  • scooping censoredDBERbabyentertainmentkikubonred babeDBER-108DBER108dber00108
    • 2021-05-25
    120 min

    [SAN-004]Adorable Young Wife With Life Skin And An Incredible Body - Real Life Calligraphy Teacher's Bold Public Fucks Marino Yura

  • haruki sato serizawa tsumugi censoredbig titslesbianSANmothermother motherSAN-004SAN004118san00004
    • 2021-05-29
    92 min

    [VEC-478]Bringing Home The Beautiful Married Woman Who Works At My Part Time Job And Fucking Her Raw Yuki Akagi

  • yuuki akagi censoredcreampiebig titsVECvenuspetermegami venusVEC-478VEC478vec00478
    • 2021-06-10
    124 min

    [FSDSS-235]Romantic Cohabitation Sex! French Kissing With Flirty Hot Girl Teacher Momo Honda

  • honda peach censoredsingle workFSDSSfalenoboomer 44faleno starFSDSS-235FSDSS2351fsdss00235
    • 2021-06-11
    119 min

    [MIAA-449]I Will Suck Off Anybody For A Set Price! If You Hire Her, You Can Call This Horny Blowjob Bitch To Give you A Lick Any Time You Want - Hana Hakuto

  • white peach censoredschoolgirlblowjobMIAAmoodyzkogoro kindaichieveryone s porn starMIAA-449MIAA449miaa00449
    • 2021-06-12
    81 min

    300MAAN-663 [Purupuru ♪ Kamijiri x Abnormal Sensitivity x Bouncing Delicate BODY] Kamijiri with erotic recoil! Slow tempo blowjob that slowly and carefully licks! Cho sensitive constitution that makes you feel swaying! Imadoki’s emo beautiful gi

  • amateur censoredcreampieamateurmaanmaan-663maan663300maan-663
    • 2021-06-20
    117 min

    [GMEM-035]Confinement! Training! Screams! Orgasms! Breaking In An Elite Undercover Investigator - Her Well-Trained Body Utterly Ravished REMI

  • remi censoredsingle workGMEMavs collector sbaba za babbyavscollector s goldGMEM-035GMEM035gmem00035
    • 2021-07-03
    54 min

    H0930 ki210703 Michiyo Nozaki 37years old

  • amateur uncensoredh0930
    • 2021-07-03
    204 min

    [DNJR-053]One Day, One Scene At A Time: Real Orgasm Management Rena Aoi

  • blue censoredslutsingle workDNJRdog daydreamersmaboroshikoDNJR-053DNJR053dnjr00053
    • 2021-07-03
    109 min

    [AWD-127]All In The Family: My Stepmom's Perfect Ass - Ultra-Thick! My Hot, Voluptuous Stepmom's Bangin' Booty Sae Asaoka

  • asaoka sae censoredbig titsmature womanAWDrubysusumu yanokuchinext doorAWD-127AWD127awd00127
    • 2021-07-05
    80 min

    345SIMM-650 [NTR] Plump busty wife drips love juice in close contact nude shooting with a young male model … Continuous convulsions cum with another stick while her husband is away [Memorial nude photo shooting]

  • amateur censoredbig titsmarried womansimmsimm-650simm650345simm-650
    • 2021-07-14
    122 min

    [FOCS-006]This Is A Truly Convenient, Good Woman My Very Own Big And Beautiful Ass, Free To Fuck As I Like! She's Completely Under My Sexual Control, And I Can Make Her Cum As Much As I Want! "Look, I Know That I'm A Convenient Woman ...

  • miona hori censoredblowjobbeautiful girlFOCSabc mousouzokufocusFOCS-006FOCS006focs00006
    • 2021-07-30
    228 min

    [BBAN-338]Masochist Girl With Big Ass And Huge Tits Lesbian Beauties - Please Fuck Me Too. Like You Fuck Her - Yui Nagase Hina Kawai Hono Wakamiya

  • yui nagase haruna kawai censoredschoolgirllesbianBBANbibianBBAN-338BBAN338bban00338
    • 2021-08-01
    60 min

    FC2PPV 1950878 [Limited Quantity] Midsummer Bikini! 22-Year-Old Dirty Little Ol G Cup ♥ Naked In The Indoor Pool! I’M In Estrus And I’M Squirming And Cum Shot Bukkake Individual Shooting [Heaven]

  • amateur uncensoredfc2
    • 2021-08-17
    131 min

    [KIRE-047]Women Who Get Horny And Wet While Sucking Other Men"s Cocks In The Afternoon. A Transsexual Who Wants Dick 34 Years Old She"ll Use Her Lusty Lips To Lure Her Married Man Neighbor To Temptation And Fuck His Brains Out ...! Yume Nanas

  • nanase yume censoredsoloworkdramaKIREsod createinugami ryourei kirei sodKIRE-047KIRE047
    • 2021-08-20
    180 min

    [OFKU-188]The Stepmother Who Had A Fight With Her Husband And Came Over To Stay At Her Stepson"s Apartment... 180 Minutes

  • censoredcreampieOFKUstar paradiseofukuro tetsudouOFKU-188OFKU188h-254ofku00188
    • 2021-09-04
    227 min

    [YMDD-241]Sex Vlogger"s Videos Blow Up And Gets Secretly Filmed Vlogger Queen

  • censoredblowjobslutYMDDmomotarou eizou shuppandukejaku momoYMDD-241YMDD241ymdd00241
    • 2021-09-17
    124 min

    [TPPN-205]Rurucha"s TEPPAN Premier! A Cum Soaked Daze With Plenty Of Squirting And Love Juice! Nonstop Group BUKKAKE

  • rurucha censoredsquirtingsingle workTPPNteppanTPPN-205TPPN205tppn00205
    • 2021-09-23
    120 min

    [JRZE-078]Entering The Biz at 50! Tomoe Okazaki

  • tomoe okazaki censoredcreampiemature womanJRZEcenter villageminami daichishoku ureJRZE-078JRZE078h-086jrze00078
    • 2021-10-09
    116 min

    [APNS-260]Breaking In A Young Lady A Hellish 30 Days She Was Broken Down, Body And Soul, And Her Womb Continuously Injected With Sperm By Filthy Men Mai Kagari

  • flower hunting censoredcreampiesingle workAPNSaurora project annexnasu yukihiroAPNS-260APNS260apns00260
    • 2021-10-09
    59 min

    Pacopacomama 100921_543 Mature Lady Piledriver Position BJ : Hitomi Okano

  • amateur uncensoredpacopacomama
    • 2021-10-23
    60 min

    1Pondo 102321_001 Men’s esthetician: Nana Kamiyama

  • amateur uncensored1pondo
    • 2021-11-06
    241 min

    [UMSO-422]Turned On By Daughter-In-Law Doing Housework So Begged Her For Blowjob! 16 People

  • haruna hana arisa hanyu arisu hanyu censoredmarried womanblowjobUMSOkm produceumanamiUMSO-422UMSO422umso00422
    • 2021-12-07
    71 min

    494SIKA-121 Etch And Sensitive Slender Blonde Gal And 3P

  • amateur censoredsquirtingamateursikasika-121sika121494sika-121
    • 2021-12-24
    106 min

    FC2PPV 2540952 [No Amateur Individual Shooting] Nasty Santa Who Is Lustful On A Holy Night Shakes His Hips Himself With A Series Of Dirty Words Saying "I Will Give You A Baby Gift" And Rolls Up! Nipple Iki! Unusual For A Cute Slender Girl Of

  • amateur uncensoredfc2
    • 2022-01-11
    488 min

    [KTRA-371]Fully Shaved Natural Airhead Young Hottie Collection - 4 Girls Record, 480 Minutes, 4-disk BOX

  • anri sayama shinozaki mio censoredbeautiful girlKTRAk tribeKTRA-371KTRA371h-094ktra00371
    • 2022-01-23
    145 min

    300MIUM-777 [Kawaii Firepower Max] Rent A Ramen Shop Clerk Who Has A Winning Face As Her! Completely Rec The Whole Story That Was Spoiled Up To The Originally Prohibited Erotic Acts By Persuading! !! From A Yukata Date & A Swimsuit Date … Nak

  • amateur censoredcreampieamateurmiummium-777mium777300mium-777
    • 2022-02-02
    145 min

    [SW-132]Cougars With Issues: Amateur Creampies. Iroha Narimiya, Age 44. Mature Woman In Her Forties From The Pages Of Erotica Found Soaked At Arakawa, Her Ample, Lewd Lower Body...

  • censoredsisterSWswitchlight fujimaswitch switchSW-132SW1321sw00132
    • 2022-02-05
    123 min

    [BACN-042]Prostitute, Slut, X, Woman. - The Story Of A Girl With Issues Who Lives By Selling Her Body - Lala Kudo

  • lara kudo censoredslutsingle workBACNbaltandaibutsu yoshidacandyBACN-042BACN042bacn00042
    • 2022-02-12
    106 min

    241GAREA-533 Marina (Leona Kirishima)

  • amateur censoredamateurbeautiful girlgareagarea-533garea533241garea-533
    • 2022-02-12
    123 min

    [ZOCM-025]This Is The Story Of A Chilling And Thrilling, Multi-Sensual Married Woman With An Overwhelming Sex Drive With Whom I Went To A Hotel In The City, On Her Ovulation Day, And Spent The Entire Day Having Babymaking Adultery Sex Until The Break

  • amane romance censoredcreampiesingle workZOCMthrilling girls the daydream tribetodothrilling girlsZOCM-025ZOCM025zocm00025



    • Jav Cherry, watch JAV streaming online japanese xxx