jav javcensored def married woman big tits




FC2HMNKBIATIDAVSADASDNACXADNNATRMIAASHKDMIDVCAWDDASDMEYDAUKSLULUSSNIVENUSANWANZ

2020-10-25
120 min

[XVSR-560]Bubble Princess Shangri-la Raw Creampie Intimate Sensual And Trembling Services Soapland Queen Azusa Misaki

  • misaki azusa censoredcreampiebig titsXVSRmax ashanty yazawacalenXVSR-560XVSR560xvsr00560
    • 2020-10-25
    108 min

    390JNT-009 [High-class beauty] Lee ● SNS pick-up of a beauty assistant at a cooking school who puts erotic selfies on the star! !! With a stunning super beautiful face, the well-trained style is also outstanding! !! A gal who is addicted to the clima

  • amateur censoredcreampiesquirtingjntjnt-009jnt009390jnt-009
    • 2020-11-06
    62 min

    328HMDN-309 [Oni cock x married woman] Personal shooting 37 years old A married woman who is quickly watered with a thick cock! Cheating mom who is addicted to the joy of being seeded after being squid until the tide blows

  • amateur censoredcreampiemarried womanhmdnhmdn-309hmdn309328hmdn-309
    • 2020-11-20
    56 min

    FC2PPV 1576936 ★ Premier amateur ☆ Yuko Takeo, a beautiful swimmer who looks like Yuko, is 22 years old again! ☆ Beauty BODY as usual ♥ Super squirrel cum shot that doubles erotic ♥ [Luxury privilege ♥ Private cum shot SEX video is also presented! ]

  • amateur uncensoredfc2
    • 2020-11-23
    119 min

    [AGAV-040]Drooling Slutty Gal's Total Giving In: Taste This Dark Gal's Slutty Spit - Kaho Imai

  • natsuho imai censoredblowjobslutAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-040AGAV040agav00040
    • 2020-11-27
    123 min

    [CRDD-005]Teens Only, Raw Creampie Western Back Street Pick Ups 004

  • censoredcreampiebig titsCRDDcrazy walkermanjiroCRDD-005CRDD005h-1518crdd00005
    • 2020-11-27
    241 min

    [MDBK-143]BAZOOKA 仕事中の巨乳美女34人とココロ踊るSEX BEST！！

  • sachiko yano tsubasa censoredbig titsMDBKk m producek taroubazookaMDBK-143MDBK143h-1496mdbk00143
    • 2020-11-28
    148 min

    [MIDE-854]She Hated Her Boss So Much She Would Rather Die Than Fuck Him, But When He Demanded That She Commit Adultery With Him, He Transformed Her Into A Prematurely Ejaculating Pussy. Mizuki Aiga

  • mizuki ai censoredsingle workMIDEmoodyzmametaro mamezawamoodyz divaMIDE-854MIDE854mide00854
    • 2020-12-09

    FC2PPV 1600459 Limited number [Uncensored] Irresponsible vaginal cum shot + bukkake for a fair-skinned beautiful girl in the first year of a nursery teacher. (49 minutes)

  • amateur uncensoredfc2
    • 2020-12-11
    42 min

    [YMDS-011]UberFucks - Gorgeous Girl - Sweet, Innocent Sex Kitten - Master Slut Ayu

  • censoredblowjobYMDSmomotaro video publishingdukeyoung peachYMDS-011YMDS011ymds00011
    • 2020-12-12
    148 min

    [EBOD-785]My Girlfriend Was Raised To Be A Perfect Lady, But She's Got A Hidden Kinky Side... Real Life J-Cup English Teacher's Porn Debut Miku Maina

  • maina miku censoredbig titssquirtingEBODe bodyichigoharaEBOD-785EBOD785ebod00785
    • 2020-12-12
    120 min

    [EBOD-789]J-Cup Extra Thick Delivery Super Aggressive Type Slutty Girl Hunts Men With Extremely Slutty Outfits Chitose Yuki

  • chitose in the evening censoredcreampieslutEBODe bodyichigoharaEBOD-789EBOD789ebod00789
    • 2020-12-16
    92 min

    435MFC-063 Sara

  • amateur censoredcreampieamateurmfcmfc-063mfc063435mfc-063
    • 2020-12-17
    63 min

    10musume 121720_01 Amateur AV Interview: I need money because my husband has had a car accident Hitomi Yoshimura

  • amateur uncensored10musume
    • 2020-12-22
    52 min

    FC2PPV 1616203 ★ First shot amateur ☆ Pochakawa busty Menhera nasty 18-year-old Kasuri-chan ☆ Over 100 experienced people ♥ Electric blame on thick pussy ♥ Extreme blowjob is the best! ♥ Zuppoli raw squirrel is too comfortable and vaginal cum shot ♥

  • amateur uncensoredfc2
    • 2020-12-24
    108 min

    [FUGA-044]Soapland Brothel Reunion With My Ex-Husband - Raw Creampie Sex With The Man I Never Wanted To Fuck Again - But I Loved It Yuki Fukuda

  • yuki fukuda censoredcreampiemarried womanFUGAcenter villagesouthern earthparadise center villageFUGA-044FUGA044h-086fuga00044
    • 2020-12-25
    123 min

    [VDD-168]Receptionist In... (Coercion Suite) Yuwa Kiriyama

  • kiriyama yuu censoreddeepthroatbdsmVDDdream tickettakuanvivid dream ticketVDD-168VDD16824vdd00168
    • 2021-01-10
    141 min

    [BADA-010]Kinky, Wild, Sensitive Wife Can't Say No To Her Husband - He Has Her Fuck A Ton Of Guys She Doesn't Know Miya Tanaka

  • miya tanaka censoredcreampieblowjobBADAbaltanminimal iwamuradiamondBADA-010BADA010bada00010
    • 2021-01-18
    31 min

    FC2PPV 1649971 [Personal shooting / Creampie] Lotion that soaks into a mature naked body. The roar of a mature wife echoes with deep pleasure …

  • amateur uncensoredfc2
    • 2021-01-30
    35 min

    FC2PPV 1665636 [4K shooting] I got in touch for the first time in 2 months and took a gonzo! A large amount of man juice overflowed from the super glossy pantyhose and the erotic mode was fully opened!

  • amateur uncensoredfc2
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-13
    119 min

    240TOKYO-411 Sayaka

  • amateur censoredanalbig titstokyotokyo-411tokyo411240tokyo-411
    • 2021-02-22
    84 min

    [MCKT-016]Hot Girls Who Love To Party! Girls Pick Up Guys To Fuck On The Street Corner Hibiki Otsuki

  • otsuki sound censoredcreampieMCKTchikikikikama delusion groupMCKT-016MCKT016mckt00016
    • 2021-02-24
    48 min

    FC2PPV 1699616 [No] [Limited to 100 pieces 2980 → 1480pt OFF!] ♥ ️ Raw Gonzo to former Tsundere maid ♥ ️ Massive vaginal cum shot! !! ♥ ️ * Review benefits / facial expression masturbation ♥

  • amateur uncensoredfc2
    • 2021-02-28
    76 min

    200GANA-2448 Seriously Nampa, first shot. 1604 Hotel IN at Tay who picks up an older sister with beautiful legs and listens to consultations! Frustrated when she touches her body while consulting her troubles, she is gradually swept away, opens her l

  • amateur censoredamateurganagana-2448gana2448200gana-2448
    • 2021-03-13
    132 min

    [USAG-026]This Precocious 18-Year Old Beautiful Girl Is Unable To Control Her Curiosity For Sex And Now She's Experiencing Her First Creampie Fuck And Deep Pussy Orgasm In This Fucked-Up Video. Teenage/Uniform Plays/Maso Sex/She Loves To Suck Dic

  • censoredcreampiebeautiful girlUSAGrabbit daydreamersUSAG-026USAG026usag00026
    • 2021-03-16
    140 min

    [SDAB-169]Small Body, Young Face, H-Cup Full Of Dreams Amu Ohara 18 Years Old SOD Only Porn Debut

  • amu ohara censoredbig titsuniformSDABsod createkomatsu 17one s youthSDAB-169SDAB1691sdab00169
    • 2021-03-26
    45 min

    [scute-1102]みるか(20)

  • amateur censoreduniformamateurscutescute-1102scute1102scute-1102
    • 2021-03-28
    71 min

    476MLA-035 [Daddy activity infiltration, Nagisa-chan edition] F cup big tits live house staff who are hungry for money and Ji ● Po in self-restraint life appeared! Ascension in agony at the grind cowgirl with outstanding rhythm! Cunnilingus cum with

  • amateur censoredbig titsamateurmlamla-035mla035476mla-035
    • 2021-03-31
    60 min

    383REIW-051 Mizuki

  • amateur censoredcreampieamateurreiwreiw-051reiw051383reiw-051
    • 2021-04-01
    106 min

    [AKDL-100](Fuckable Girls At Work) Our Adorable New Hire Became My Fuck Buddy While I Was Training Her - Creampie Sex And Cum Swallowing Caught On Camera - The Accounting Department's Kanon (Age 22) Kanon Amane

  • natural kano censoredcreampiebeautiful girlAKDLaquinoriaquinoriaknrAKDL-100AKDL1001akdl00100
    • 2021-04-02
    120 min

    [JUL-530]My Big Brother Died Early, And He Asked Me To Take Care Of His Family, So I Took Care Of His Stepmom And His Wife And Started Breaking In Both Bitches With Creampie Sex And Domesticated Them.

  • tsukishima sakura asuka riina censoredcreampiebig titsJULmadonnaunicorn fukudaJUL-530JUL530jul00530
    • 2021-04-15
    117 min

    [DDOB-091]Pussy Cumming Paradise Sexually Frustrated Married Woman Screams, Thrashes, And Foams While Cumming For The First Time! Kayo Iwasawa

  • kayo iwasawa censoredsquirtingmature womanDDOBdogmatenunmy auntDDOB-091DDOB091ddob00091
    • 2021-04-23
    123 min

    [MIAA-428]This Real-Life Nurse Makes Men Cum In Bondage In Her Spare Time! Massive Loads Of Male Squirting - Tied Up And Ravished For Every Last Drop Of Seed By A Masterful Domme Slut Mikako Horiuchi, Age 23

  • mikako horiuchi censoredcreampieslutMIAAmoodyzmiyoshi rushereveryone s porn starMIAA-428MIAA428miaa00428
    • 2021-05-18
    67 min

    Pacopacomama 051821_478 Dirty Secret Affair Trip with This Cute Wife Hasumi

  • amateur uncensoredpacopacomama
    • 2021-05-28
    136 min

    [MIDE-933]My Big Tits Girlfriend And I Confined Ourselves To A 2-Day, 1-Night Hot Spring Resort Vacation Where All We Did Was Fuck Our Brains Out Fumika Nakayama

  • nakayama fumika censoredbig titssingle workMIDEmoodyzmametaro mamezawamoodyz divaMIDE-933MIDE933mide00933
    • 2021-06-04
    240 min

    [DVDMS-670]The MM Special Edition These Adult Video Actresses Are Friends, And Are Taking The "Put Your Hearts Together And Escape" Game Challenge! 2 Kissing / Titty Fondling / Big Vibrator Action / Blowjob Action / Creampie Sex Pick One And

  • hanaoto urara yui nagase censoredcreampieDVDMSdeepsmurahachibuthe magic mirror mm mm flightsDVDMS-670DVDMS670dvdms00670
    • 2021-06-04
    61 min

    10musume 060421_01 I like traveling alone, but I like sex more with the guys I met while traveling Ayano Fujita

  • amateur uncensored10musume
    • 2021-06-27
    239 min

    [RDVHJ-134]Picking Up Amateur Housewives! Gallons Of Squirting! Gallons Of Creampie Jizz! 12 Loads! 4 Hours!

  • censoredbig titsmarried womanRDVHJgraffiti japanfair estRDVHJ-134RDVHJ13448rdvhj00134
    • 2021-07-02
    117 min

    [JUL-634]Exposed Record Of A Married Woman: She Makes It Seem Like She Is A Chaste Wife, But In Secret She Turns Into A Slut Wife. Iori Nanase

  • iori nanase censoredcreampiebig titsJULmadonnanagaeJUL-634JUL634jul00634
    • 2021-07-09
    92 min

    [393OTIM-081]【妄想主観】痴女美少女と濃厚性交 あおいれな

  • amateur censoredcreampieamateurotimotim-081otim081393otim-081
    • 2021-07-13
    244 min

    [STARS-403]What's So Wrong With Being Lovers？ This Beautiful Lady Is Of The Highest Grade, And She Never Gets Excited Unless She's Committing Adultery, And Now You Get To Have Endless Cuckolding Sex Until The Break Of Dawn! A Graduation Comme

  • hiiragi kaede censoredslutSTARSsod createcrestsod starSTARS-403STARS4031stars00403
    • 2021-07-17
    120 min

    [DASD-892]Newlywed Flirtation With A Beautiful Trans Bride, Starring Sara Aizawa

  • aizawa sara censoredanalbeautiful girlDASDdashiromichi hoseDASD-892DASD892dasd00892
    • 2021-07-18
    115 min

    [AGMX-084]A Puddle of Drool. Really Rough Sex. Handjob.

  • nana matsumoto misuzu kawana censoredhandjobAGMXsex agentyoshida great buddhaAGMX-084AGMX084agmx00084
    • 2021-07-22
    110 min

    [FSDSS-253]I Went On A Business Trip And Got Booked Into The Same Hotel Room With My Lady Boss. She Scolded Me And Pussy-Pounded 10 Cum Shots Out Of Me Until The Break Of Dawn Minori Kawana

  • real village henan censoredcreampieblowjobFSDSSfalenomanyufaleno starFSDSS-253FSDSS2531fsdss00253
    • 2021-08-07
    91 min

    [ANX-136]A Strong Addiction To Being Not Quite Yourself: Her Territory - A New Area. Maina Yuuri.

  • yuuri censoredbig titscosplayANXsaimin kenkyuusho bekkansainansaimin rei onna saimin kenkyuusho bekkanANX-136ANX136anx00136
    • 2021-08-26
    122 min

    [FSDSS-276]Slut Gets A Dick Off Many Times Over With Thorough Nipple Play And Tongue Fondling At Massage Parlor. Yume Nikaido

  • nikaido yume censoredbig titsbeautiful girlFSDSSfalenogoemonfaleno starFSDSS-276FSDSS2761fsdss00276
    • 2021-09-09
    125 min

    [NEO-763]Gal Saliva Bullying Runa Shimotsuki

  • shimotsuki runa censoreddeepthroatsingle workNEOradixsakuraba kyuu kokoro otokoneo radixNEO-763NEO763433neo00763
    • 2021-09-17
    154 min

    [PRED-343]"No Way To Forget The Body On That Teacher..." Rubbing Her Tits And Giving The Teacher Tons Of Creampie Action On A Day That Feels Like A Miracle.

  • julia censoredcreampiesingle workPREDpremiumtorendei yamaguchielegancePRED-343PRED343pred00343
    • 2021-09-20
    120 min

    [DMAT-197]Bringing Home In A Tipsy Woman Who Was Resting In The Building"s Corridor

  • censoredcreampieDMATstar paradisesilenceDMAT-197DMAT197h-254dmat00197
    • 2021-09-25
    78 min

    200GANA-2563 Seriously Nampa, First Shot. 1695 Get A Beautiful Female College Student With Fair Skin By Picking Up! While Being Ashamed Of The Camera For The First Time, A Busty Beautiful Girl Who Loses Pleasure And Panting With A Fascinating Face! !

  • amateur censoredbig titsamateurganagana-2563gana2563200gana-2563
    • 2021-10-08
    231 min

    [SKMJ-213]Amateur College Girl Nampa Seduction! See What Happens When We Get Rid Of These Rubbers In The Middle Of Sex! This Big Dick Felt So Good That This Young Lady Begged For Sex With Teary Eyes, So We Told Her, "Well Start Taking The Pill, B

  • censoredcreampieamateurSKMJsekimenjoshiwantoppusekimen goshiSKMJ-213SKMJ213h-1324skmj00213
    • 2021-10-18
    92 min

    230OREC-914 Yuuna (Ran Tsukishiro)

  • amateur censoredcreampieamateurorecorec-914orec914230orec-914
    • 2021-10-27
    46 min

    [102721-001]Popular Japanese Porn Actor Will Tell You : How to Make Love in The Right Way 2

  • arisa nakano uncensoredcaribbeancom
    • 2021-11-05
    120 min

    [JUL-761]元CMタレント妻第3弾！！人気シリーズに登場！！ 母の友人 天河みなせ

  • minase tianhe censoredmature womanslutJULmadonnakawaijou osamuJUL-761JUL761jul00761
    • 2021-11-20
    68 min

    H4610 ki211121 Ayumi Hinamori 31years old

  • amateur uncensoredh4610



    • Jav Cherry, watch JAV streaming online japanese xxx