jav javcensored creampie daydreamers censored




FC2HMNCJODSDABAVSAJUFENNPJSTARSBBANBLKDASDDASDSHKDMIDVPREDHDKAMEYDVENXNGODAPODEBOD

2020-12-22
60 min

H0930 ki201222 Misa Oohara 45years old

  • amateur uncensoredh0930
    • 2021-01-06
    44 min

    [sika-009]もも(18)

  • amateur censoreduniformschoolgirlsikasika-009sika009sika-009
    • 2021-01-09
    142 min

    [EBOD-791]She Can Never Turn Down An Invitation!？ This Natural Airhead Otaku Girl Is Unwittingly Luring Men To Temptation With Her Titties This H-Cup Otaku Nerd Is Self-Conscious But Very Kind And Gentle, And When She Gets Loaded With Cock, She Turns

  • first love censoredbig titssingle workEBODe bodymametaro mamezawaEBOD-791EBOD791ebod00791
    • 2021-01-15
    245 min

    [TUS-092]120％リアルガチ軟派伝説 vol.92 乳に大小あれど貴賎なし！まとめて愛する245分！

  • censoredcreampiebig titsTUSprestigetsuri shiTUS-092TUS092118tus00092
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-26
    80 min

    200GANA-2425 Seriously Nampa, first shot. 1587 Get a G-Cup Sales Lady in a Muchimuchi Suit! Super erotic amateur ww who is in agony while shaking plump boobs with pantyhose breaking sex

  • amateur censoredbig titsamateurganagana-2425gana2425200gana-2425
    • 2021-01-28
    77 min

    435MFC-076 [Gonzo] RIN / RIN / 23 years old / Parlinai with bitch gal and tipsy SEX

  • rinrin censoredcreampiebig titsmfcmfc-076mfc076435mfc-076
    • 2021-01-30
    120 min

    [WAAA-029]Intently Raw Creampie With A Housewife Dripping In Pheromones! Affair Fucking with Riho Fujimori

  • riho fujimori censoredcreampiebig titsWAAAwanz factorywanzWAAA-029WAAA029waaa00029
    • 2021-02-16
    65 min

    SIRO-4423 [First shot] [De M thirty woman] [Screaming screaming ..] Sensitive lady who is shy about handsome guys drowns in pleasure. Was sex after a long time more pleasant than I imagined .. Application amateur, first AV shooting 193

  • amateur censoredamateursirosiro-4423siro4423siro-4423
    • 2021-02-20
    151 min

    [GS-2008]Married Woman Hot Water Love Trip 137

  • censoredmarried womanGSgostakeshi karakiGS-2008GS2008
    • 2021-02-23
    72 min

    200GANA-2444 Seriously Nampa, first shot. 1602 A fashionable celebrity married woman who suffers from sexlessness even though she is a newlywed found in Omotesando! Frustrated with having sex 3 months ago! The libido that was suppressed by stimuli ot

  • amateur censoredbig titsmarried womanganagana-2444gana2444200gana-2444
    • 2021-02-26
    41 min

    FC2PPV 1703186 [Sexual spring] Omanko in full bloom ★ First vaginal cum shot video Now GET a female college student! Portio is pierced by the first aphrodisiac cock and demon convulsions acme! The best body of 19 years old is conceived with the whole

  • amateur uncensoredfc2
    • 2021-02-27
    181 min

    [WAAA-034]If You Can Withstand Ai Sayama's Amazing Technique, You Can Have Raw Creampie SEX With Her!

  • sayama love censoredcreampieslutWAAAwanz factorywanzWAAA-034WAAA034waaa00034
    • 2021-03-04
    115 min

    435MFC-086 Super horny slut who is immersed in pleasure by inserting two holes at the same time [Gonzo ＃ Ayaka ＃ 25 years old ＃ G cup]

  • amateur censoredcreampiebig titsmfcmfc-086mfc086435mfc-086
    • 2021-04-02
    78 min

    383REIW-053 Saya

  • amateur censoredamateurreiwreiw-053reiw053383reiw-053
    • 2021-04-03
    242 min

    [MMB-356]10 Genuinely Degenerate Housewives Who Were Fooled On April Fools Day And Got Creampie Fucked - Please Don't Make A Fool Out Of Me! You Sexy Housewives! -

  • censoredcreampieMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-356MMB356mmb00356
    • 2021-04-09
    148 min

    [MIDE-912]Super Steamy, Sweet, And Sexy Losing My Virginity In The Best Way Possible Nozomi Ishihara

  • ishihara hope censoredbig titsblowjobMIDEmoodyzdragon nishikawamoodyz divaMIDE-912MIDE912mide00912
    • 2021-04-17
    116 min

    [NNPJ-443]I Offered The Bold Babe Who Was Giving Me A Business Trip Massage A Huge Tip And To My Surprise She Was Down To Fuck For It Sarina

  • censoredcreampiebig titsNNPJnanpa japanNNPJ-443NNPJ443nnpj00443
    • 2021-04-26
    48 min

    492JCHA-035 There is no reason why JK taken in erotic videos is naive! Four

  • amateur censoreduniformschoolgirljchajcha-035jcha035492jcha-035
    • 2021-05-07
    112 min

    [RCTD-400]A Strategy To Influence Women In Mourning!？ A Pretty Beauty Turns Into A Dark, Filthy And Vulgar Woman In Mourning!？

  • miko shion suzuka walnut censoredslutRCTDrocketroute yamazakiRCTD-400RCTD4001rctd00400
    • 2021-05-13
    63 min

    10musume 051321_01 The School Uniform: While we were talking, she had already been wet Manami Nishi

  • amateur uncensored10musume
    • 2021-05-15
    139 min

    [TIKB-108][Godly Times] A Video Of A Girl With Glasses And Colossal Tits Who Gets Into The Sugar Daddy Lifestyle By Luring Men With Lewd Videos Of Herself Posted on Websites

  • censoredcreampiebig titsTIKBtikitiki.comerTIKB-108TIKB108tikb00108
    • 2021-05-22
    148 min

    [JUKF-062]Ripe Young Fruit Hikaru-chan Hikaru Minazuki

  • hikaru minazuki censoredcreampiesingle workJUKFjumpjump avJUKF-062JUKF062h-227jukf00062
    • 2021-05-25
    34 min

    FC2PPV 1835807 [No] Limited time !! Super neat !! Super beautiful and super beautiful legs Nagusho wet shaved nursery teacher inserts rich continuous raw (Part 2)

  • amateur uncensoredfc2
    • 2021-06-19
    121 min

    [NNPJ-455]Outdoor Kissing S********ls - Car Date Moves To A Love Hotel For 6 Raw Loads

  • censoredcreampieuniformNNPJnanpa japanNNPJ-455NNPJ455nnpj00455
    • 2021-07-02
    61 min

    SIRO-4540 [First shot] [Tohoku beauty with beautiful breasts] A fair-skinned beauty from Tohoku. She spends fulfilling days, but the devil is in her sexual desire that is increasing year by year .. AV application on the net → AV experience shooting 1

  • amateur censoredamateursirosiro-4540siro4540siro-4540
    • 2021-07-05
    80 min

    345SIMM-650 [NTR] Plump busty wife drips love juice in close contact nude shooting with a young male model … Continuous convulsions cum with another stick while her husband is away [Memorial nude photo shooting]

  • amateur censoredbig titsmarried womansimmsimm-650simm650345simm-650
    • 2021-08-28
    64 min

    SIRO-4605 [First shot] [Slender beauty] [Beautiful Momojiri] Discovered a beautiful receptionist with high quality parts in a delicate body. The more wrinkles are drawn between her eyebrows, the more the shocked body of the big cock falls to the bott

  • amateur censoredsquirtingamateursirosiro-4605siro4605siro-4605
    • 2021-08-29
    42 min

    292MY-460 Sho Miyoshi 2

  • amateur censoredcreampiemarried womanmymy-460my460292my-460
    • 2021-09-10
    238 min

    [IDBD-850]She Tried To Resist, But Succumbed To The Pleasure, And With Each Fuck, She Found Herself Desiring More And More Stimulation ... A Melancholy Erection! A Collection Of Exclusive Idea Pocket Actresses In Cuckolding Situations

  • nanami misaki akari tsumugi censoredbig titsdramaIDBDidea pocketaideapoketto bestIDBD-850IDBD850idbd00850
    • 2021-09-22
    41 min

    396BIG-111 Minami

  • amateur censoredcreampieschoolgirlbigbig-111big111396big-111
    • 2021-10-02
    240 min

    [YMDD-247]Thank You! Nacchan ! Endless J Cup Super Colossal Tits Fuck Doll! Natsuko Mishima Retirement Highlights

  • natsuko mishima censoredcreampiebig titsYMDDmomotaro video publishingdr ishikiri bridgeyoung peachYMDD-247YMDD247ymdd00247
    • 2021-10-08
    124 min

    [NKKD-228]Fondling Sweaty And Sopping Wet See-Thru Colossal Tits NTR A Colossal Tits Housewife Gets Fucked To Dripping Wet, Transparently Sweaty Ecstasy By The Plumber Hana Haruna

  • haruna hana censoredmature womansingle workNKKDjet eizougroupNKKD-228NKKD228nkkd00228
    • 2021-10-18
    66 min

    530DG-019 ＃ 3 Female ○ Student By Convenience Store Manager ●●●● Video

  • amateur censoredcreampiebig titsdgdg-019dg019530dg-019
    • 2021-10-23
    86 min

    FC2PPV 2365430 Until 10/24 [5980pt → 1980pt] [Face Barre] [Beautiful Girl] Slope-Based Idol Audition Finalist! Premier Version With Complete Recording Of Unreleased Footage!

  • amateur uncensoredfc2
    • 2021-10-29
    120 min

    [SHKD-974]Newlywed Hiyori-sensei Is The Best In The School. Made to Be Sex Toy of Rough Class Members. Minami Hatsukawa

  • hatsukawa minami censoredsingle workSHKDattackerskitorune kawaguchishi yoru akuSHKD-974SHKD974shkd00974
    • 2021-11-11
    103 min

    [ZEAA-067]Married Woman Alice Otsu Turned On By Bondage, Training Request Collection

  • otsu alice censoredcreampiemarried womanZEAAcenter villagemurakithe pole center villageZEAA-067ZEAA067h-086zeaa00067
    • 2021-12-10
    154 min

    [DASD-945]Cuckolded By Dispatch Massage Therapist Who Touched Sensitive Parts So Much That I Could Not Stand The Pleasure. Maron Natsuki

  • marin natsuki censoredbig titssingle workDASDdasrokusaburo mishimaDASD-945DASD945dasd00945
    • 2021-12-10
    218 min

    [HUNTB-161]On A Timid Business Trip For A Huge Ass And Big Tits - Maid With Huge Ass Takes A Fully Hard Big Dick During A Quickie! Setting Aside Bad Feelings To Keep Pounding "Stop! That"s Enough Fucking!" Giving Into Pleasure!

  • censoredcreampiebig titsHUNTBhuntervolvo nakanohhh groupHUNTB-161HUNTB161huntb00161
    • 2021-12-24
    123 min

    [DFE-057]I Am Eating Up This Y********l. Rena Usami

  • reina usami censoredcreampieuniformDFEwaap entertainmentnishiki sasafearlessDFE-057DFE0572dfe00057
    • 2021-12-24
    167 min

    [HMN-100]I Had Creampie Sex With A Devilishly Professional Infidelity Elder Sister Type Who Kept On Developing My Anal Sexual Buds, Day After Day, Until I Learned How To Cum Like A Bitch. Asuka Momose

  • momose asuka censoredanalcreampieHMNhon nakanao masakiHMN-100HMN100hmn00100
    • 2021-12-27
    285 min

    [DGCEDG-004]配信限定版 成宮いろはハイパーベスト4時間49分

  • narumiya iroha censoredDGCEDGcelebrity friendsDGCEDG-004DGCEDG004dgcedg00004
    • 2021-12-27
    184 min

    [DGCEDG-005]Delivery Only Edition Ichigo Aoi Hyper Best 3 Hours 06 Minutes

  • aoi strawberry censoredmarried womanmature womanDGCEDGcelebrity friendsDGCEDG-005DGCEDG005dgcedg00005
    • 2022-01-01
    123 min

    [SORA-354]A Personality-Altering, Mind-Blowing Experience No Masks, No Thank You! In This Edition, You Get To Take Over Our Label"s "AkariMix" And Convert Her, Fuck Her, Mount Her, And Take Over! Akari Niimura

  • akari shinmura censoredsingle workdramaSORAyama to soraSORA-354SORA354sora00354
    • 2022-01-02
    133 min

    [010222-001]Pussy Encyclopedia: Miki Hoshino, Rena Hiiragi, Ann Himukai, Minori Koike, Aya Eikura, Kanae Murakami, Chiaki Saeki, Rumi Kanzaki

  • amateur uncensoredcaribbeancom
    • 2022-01-07
    121 min

    [BBAN-356]Y********l Who Wants my Body Grins and Kissed Me Deeply...Deep Hot Sexy Kissing Leads to Naked Hot Lesbian Orgasms. Mizuki Amane. Himari Kinoshita.

  • natural mizuki himari kinoshita himari hanazawa censoredschoolgirllesbianBBANbibianBBAN-356BBAN356bban00356
    • 2022-01-07
    155 min

    [BBAN-357]Drowning In Saliva Full-Body Lesbian Licking Ena Satsuki"s Lesbian Awakening Honoka Tsujii Yumi Saeki

  • ena satsuki tsujii honoka censoredlesbianbeautiful girlBBANbibianBBAN-357BBAN357bban00357
    • 2022-01-29
    241 min

    [EMBZ-244]Housewives Fallen Into The Trap Of The Dark Massage Salon. They Are Given Resting Pills And Given A Creampie While In A Sleep, And After Waking Up, They Are Given Oil Treatment, And The Wombs Of The Wives Go Crazy With Domination.

  • kazumi ikeya nonomiya ran censoredcreampieEMBZjuku onna juku emmanuellejuku onna jukuEMBZ-244EMBZ244embz00244
    • 2022-01-30
    60 min

    [013022-001]Insert big cock right before climax from masturbation: she can"t stop coming!

  • sakura kojima uncensoredcreampiehandjobcaribbeancom
    • 2022-02-03
    64 min

    [REBD-625]Mai. Temptation Beyond The Lens And Mai Kanami.

  • kanna mimai censoredsingle workREBDrebeccarimu ozawaREBD-625REBD625h-346rebd00625
    • 2022-02-04
    132 min

    [IPX-813]Reverse Bunny Costume Play Situations With Exposed Tits. Max Volume. Momonogi"s 10 Erotic Changes! Kana Momonogi

  • kana momonogi censoredcosplaysingle workIPXidea pocketinaballdishIPX-813IPX813ipx00813
    • 2022-02-05
    130 min

    [AVSA-192]Super Up-Close Footage & Bukkake, Colossal Tits And Curvy Slut Fucked Out Of Her Mind Hikari Sena

  • hikari sena censoredbig titssingle workAVSAavs collector shikaru jingujiavscollector sAVSA-192AVSA192avsa00192
    • 2022-02-26
    240 min

    [MMB-406]For March 3rd When We Celebrate The Dolls" Festival! The 10 Most Erotic Actresses of the Year As Selected By 10,000 Users + 1 Creampie Sex Compilation.

  • aika yui hatano censoredcreampieslutMMBmomotaro video publishingdr ishikiri bridgemomotaro bestMMB-406MMB406mmb00406
    • 2022-03-05
    43 min

    H0930 ki220305 Naoko Takeda 46years old

  • amateur uncensoredh0930
    • 2022-03-17
    80 min

    336KNB-198 [H Cup Married Woman And Adult Carnal Sex] Former Nurse’s President’s Wife Is Frustrated And Applies For Av! I Have To See The Huge Breasts H Cup Of Max With A Feeling Of Elasticity That I Can Not Think Of In My 40s! !! At Nakaga

  • amateur censoredbig titsmarried womanknbknb-198knb198336knb-198
    • 2022-03-18
    130 min

    [OPUD-345]Ms Sakura"s Shits, Pisses, Farts, And Enema Spray

  • censoredamateurOPUDoperaOPUD-345OPUD345opud00345



    • Jav Cherry, watch JAV streaming online japanese xxx