jav censored javcensored massage refre




FC2JUFEEBODBBANNACXROYDWAAAAVSACHRVMEYDHMNMILKSHKDSQTECJODHDKAKBIMIDEFSDSSMVSDATID

2020-10-02
63 min

[KBTV-026]We Heard That This College Girl Was Secretly The Neighborhood Cum Dumpster, But Is It True？ We Find Out!

  • censoredamateurblowjobKBTVgoing too far tvKBTV-026KBTV026h-1514kbtv00026
    • 2020-10-03
    95 min

    [RBD-990]The House Where She Lives - Sara Kagami, Yuria Toda

  • kagami sara yuria toda censoreddramaRBDattackersnagira kenzoryupakuRBD-990RBD990rbd00990
    • 2020-11-12
    122 min

    [GS-363]Female Employees Who Get Married To Their Co-Workers Are Perverted Bitches This Female Staff Member Who Got Married To Her Co-Worker Came To Me For Advice, So I Listened, And Then... She Said To Me, The Truth Is, I'm In Love With You!？

  • censoreduniformschoolgirlGSsosoru x garconspada ikebukuroGS-363GS363h-101gs00363
    • 2020-11-19
    89 min

    [hoi-145]萌(21)

  • amateur censoredbig titsamateurhoihoi-145hoi145hoi-145
    • 2020-11-23
    166 min

    [QRDA-119]Totally Undercover ! An Undercover Report From An S&M Club!! Each Club Is Offering Their Most Popular S&M Queen For Some Exclusive Filming 2

  • akira minase censoredanalQRDAqueen roadQRDA-119QRDA119qrda00119
    • 2020-12-17
    153 min

    [SSNI-939]Teased To Your Limit - Edging And Aphrodisiac Orgasms - The Ultimate Pleasure Yua Mikami

  • yua mikami censoredbig titssquirtingSSNIs1 no 1 stylekyoseiSSNI-939SSNI939ssni00939
    • 2020-12-17
    49 min

    285ENDX-319 Baby-faced slender 21-year-old female college student I will allow vaginal cum shot twice with my favorite type opponent

  • amateur censoredsquirtingamateurendxendx-319endx319285endx-319
    • 2020-12-26
    119 min

    [MIDE-867]Premature Ejaculations, Convulsions And Orgasms Sp. Mizuki Aime

  • mizuki ai censoredsquirtingsingle workMIDEmoodyzzaku araimoodyz divaMIDE-867MIDE867mide00867
    • 2020-12-27
    78 min

    H4610 ki210102 Gold Pack 20years old

  • amateur uncensoredh4610
    • 2020-12-31
    100 min

    AVKH-190 Mashima Aya

  • amateur censoredamateuravkhavkh-190avkh190avkh-190
    • 2021-01-18
    48 min

    IDJS-030 Miki

  • amateur censoredcreampieamateuridjsidjs-030idjs030idjs-030
    • 2021-01-23
    127 min

    [JUL-451]I Got Outed As A Cherry Boy By The Married Woman Next Door And Now I'll Do Whatever She Says. Ayaka Muto

  • ayaka muto censoredmature womanslutJULmadonnaunicorn fukudaJUL-451JUL451jul00451
    • 2021-02-01
    71 min

    [HKHS-010]Picking Up Girls In L.A.: Slender Body, Beautiful Legs And A Great Ass - Be Impressed By Her Wonderful Leg Techniques - Nora, 28

  • censoredcreampieamateurHKHShikara delusion grouphollywood saburoHKHS-010HKHS010hkhs00010
    • 2021-02-06
    52 min

    FC2PPV 1674481 Devil’s Blade-Beautiful young landlady of a certain inn-Participation of the first string [No]

  • amateur uncensoredfc2
    • 2021-02-11
    67 min

    435MFC-080 [Gonzo with beautiful breasts] Gonzo with a selfish body erotic girl with beautiful breasts / Waka / 23 years old / G cup (big breasts)

  • amateur censoredcreampiebig titsmfcmfc-080mfc080435mfc-080
    • 2021-02-11
    56 min

    [orec-692]みお

  • amateur censoredcreampiebig titsorecorec-692orec692orec-692
    • 2021-02-14
    55 min

    FC2PPV 1685754 [Limited 1480pt] First shot first cum shot ── Miraculous slender beauty big tits !! 21-year-old G cup popular Caba Miss raw Saddle cum shot SEX, further scooping sperm and reinserting [Personal shooting]

  • amateur uncensoredfc2
    • 2021-02-15
    480 min

    [NPS-408]Female Director Haruna Amateur Lesbian Seduction: 60 Girls, 8 Hours Best Collection 16

  • abe mikako kato camellia censoredamateurlesbianNPSpetersnampaNPS-408NPS408h-021nps00408
    • 2021-02-21
    120 min

    [OBA-412]Are You Happy Doing It With Such An Older Woman...？ Having An Enthusiastic Affair With A Younger Man In Her Workpalce - Miya Tanaka

  • miya tanaka censoredbig titsmature womanOBAmadonnavivaobasanOBA-412OBA412oba00412
    • 2021-03-02
    63 min

    SIRO-4442 [First shot] [Foolery of sticky skin JD] [Signboard girl of general store] An active female college student with an appearance reminiscent of a favorable announcer. Contrary to her neat appearance .. AV application on the net → AV experienc

  • amateur censoredamateursirosiro-4442siro4442siro-4442
    • 2021-03-06
    60 min

    C0930 ki210307 Yukiko Motofuji 26years old

  • amateur uncensoredc0930
    • 2021-03-15
    110 min

    300MIUM-694 [Creampie in H cup OL! ] A tall office lady with a lump of aesthetics and a trip to skip! If you peel off the skin of 120 throat big breasts, you’ll have too many dreams and you’ll be out of control! !! Roll up the hustle in the

  • amateur censoredcreampiebig titsmiummium-694mium694300mium-694
    • 2021-04-08
    62 min

    230OREC-731 Honest

  • amateur censoredcreampiebig titsorecorec-731orec731230orec-731
    • 2021-04-14
    195 min

    [HUNBL-042]After School Agony Deepthroat Release

  • censoredcreampiedeepthroatHUNBLhuntergeminihhh groupHUNBL-042HUNBL042hunbl00042
    • 2021-04-15
    240 min

    [KNMD-103]My Sexy Body Can't Help But Feel Good When Fucked By My Step Dad 4 Hours

  • censoredmarried womanmature womanKNMDkinemamanjiroKNMD-103KNMD103knmd00103
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-13
    130 min

    [MEKO-210]All New "The Old Lady Rental Service" 13 There Was A Rumor That This Popular Housecleaning Service Would Let You Have Creampie Sex, So We Made Even More Extreme Demands To See How Far We Could Go

  • censoredcreampieamateurMEKOjukujo laboMEKO-210MEKO210h-1160meko00210
    • 2021-05-26
    83 min

    435MFC-109 [Small Devil-based Libido Monster JD] Slender and Shaved Saffle and Norinori Tipsy SEX ♪ Deriheru Preparation Technique Chi ○ Pogatchigachi ↑↑ The big cock is too comfortable to stop swinging and panting Excellent sensitivity by rolling! !

  • amateur censoredcreampieamateurmfcmfc-109mfc109435mfc-109
    • 2021-05-29
    57 min

    358WITH-102 Maron (24) S-Cute With Gonzo SEX With A Beautiful Woman Who Self-lives At The Cowgirl

  • amateur censoredcreampiebig titswithwith-102with102358with-102
    • 2021-06-04
    64 min

    518ASGM-005 [Sleep Fucking / Intravaginal Ejaculation] Yokohama Skirt Beautiful Girl Hidden Camera (Kanagawa / Private / Ordinary Course) Estimated D Cup

  • amateur censoredcreampieamateurasgmasgm-005asgm005518asgm-005
    • 2021-06-11
    32 min

    FC2PPV 1864290 * Complete appearance for a limited time I stayed at a certain store’s hostess overnight at home and had vaginal cum shot sex (u-i01)

  • amateur uncensoredfc2
    • 2021-06-16
    134 min

    [ROYD-060]When I Got My First Girlfriend, We Used This Camera To Film So Many Wonderful Memories ... And Now, I'm Using It To Film My Scary Friend While He Fucks Her ... And All The While, I Have A Melancholy Erection, That Just Won't Stop ..

  • rio matsumoto censoredcreampiesingle workROYDroyalkawajirihhh groupROYD-060ROYD060royd00060
    • 2021-06-30
    48 min

    FC2PPV 1895147 Limited number! [Uncensored] "Momo-only this time …" A hidden busty student with E-cup big tits popping out when she takes off her uniform! Take the promised thing and vaginal cum shot! !!

  • amateur uncensoredfc2
    • 2021-07-11
    80 min

    413INST-138 [Active gravure outflow] Reiwa’s H cup Active gravure Introduced from acquaintance P Cosplay individual shooting sexual intercourse Cock-loving Slut who eats a man

  • amateur censoredcreampiebig titsinstinst-138inst138413inst-138
    • 2021-07-17
    165 min

    [ROE-002]Beauty, Sexy, First Class. Porn Debut Of A Former Air Stewardess Nozomi Sakai Aged 45

  • nozomi sakai censoredmature womansingle workROEmadonnamametaro mamezawamonroeROE-002ROE002roe00002
    • 2021-07-20
    120 min

    [DOKI-015]When I Had A Few D***ks With My Female Superior At The Hotel Where We Were Staying On Our Business Trip...

  • censoredcreampieDOKIstar paradisedokiDOKI-015DOKI015h-254doki00015
    • 2021-07-23
    111 min

    [hoi-193]美果(25)

  • amateur censoredbig titsamateurhoihoi-193hoi193hoi-193
    • 2021-07-28
    65 min

    ION-094 Reiko

  • amateur censoredcreampiebig titsionion-094ion094ion-094
    • 2021-07-30
    115 min

    [JUL-671]I"d Never Tell My Wife That I Impregnated My Mother-In-Law...2 Days 1 Night Hot Springs Trip Where I Lose Myself And Creampie Her. - Yumi Kazama

  • kazama yumi censoredcreampiebig titsJULmadonnaunicorn fukudaJUL-671JUL671jul00671
    • 2021-07-30
    141 min

    [BF-639]She may look plain but underneath her clothes, she is hiding a slender body, big G-cup tits, and a super tight waist! She seduces men by riding them hard in the cowgirl position. - Kokone Nakamura

  • nakamura here censoredcreampiebig titsBFbefreeBF-639BF639bf00639
    • 2021-08-01
    120 min

    [NACR-446]Competing With A Young Lover Chisato Shoda Mio Saionji

  • shota chisato mio saizonoji censoredbig titsmature womanNACRplanet plussakura ninshichi ku ryuuNACR-446NACR446h-237nacr00446
    • 2021-08-13
    161 min

    [PPPD-952]120 Points For Those Boobs! She"ll Do Anything A Beauty Wouldn"t do. A Convenient Meaty Big Tits Girl"s JAV Debut. Kotoha Ayase

  • ayase is censoredbig titssingle workPPPDoppaiPPPD-952PPPD952pppd00952
    • 2021-08-14
    104 min

    [AARM-008]A Girl Who Pinches Things Between Her Legs With Her Crotch Aching From Nipple Masturbation

  • narita tsumugi kira an censoredbig titsAARMaroma kikakuhamu oujiaromaAARM-008AARM008aarm00008
    • 2021-08-20
    119 min

    [NNPJ-465]Persistent Pick-Up Artist Celeb Gets A Cute E-Cup Girl

  • censoredcreampieuniformNNPJnampa japanNNPJ-465NNPJ465nnpj00465
    • 2021-09-10
    226 min

    [HUNTB-096]"I Don"t Think I"ll Get Another Chance... So I"m Telling You Now: I"m In Love With You." The Story Of How My Coworker Boldly Invited Me Back To Her Place.

  • censoredblowjobbeautiful girlHUNTBhunterspace nyanjirohhh groupHUNTB-096HUNTB096huntb00096
    • 2021-09-11
    41 min

    362SCOH-047 [Creampie] Let A Carefully Selected Beautiful Girl Cosplay And Conceive My Child! [Time ● Kyouzo] Akari Niimura

  • amateur censoredcreampiebig titsscohscoh-047scoh047362scoh-047
    • 2021-09-28
    46 min

    FC2PPV 2258281 780 Yen! [4K Video] Norinori 3p! Even Though It’s Just After Debut, It’s Switched On And It’s A Nasty Play ♪ Creampie & Mouth Shot! Plump Busty Ring G Cup 19 Years Old JD1 Himari-Chan Chapter 1 _ Bonus

  • amateur uncensoredfc2
    • 2021-10-02
    140 min

    [PKPD-164]H Cup Chubby Cosmetologist Fuck Buddy Misono Is Healing And So Cute, Misono Mizuhara

  • suwon miso censoredcreampiebig titsPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-164PKPD164pkpd00164
    • 2021-10-15
    119 min

    [MEYD-707]Goro Tameike A 15th Anniversary Year Collaboration No.9 The Big Tits Married Woman From Next Door Seemed Like A Plain Jane But One Day, She Accidentally Walked In On Me While I Was In The Middle Of Masturbation. She Didn"t Look It, But

  • reina taoyuan censoredcreampiebig titsMEYDtameike goroshouten shirouMEYD-707MEYD707meyd00707
    • 2021-10-15
    158 min

    [JUNY-046]I Have The Most Convenient Woman In History, Because I Only Call Her When I Want To Fuck This Meaty Bitch Will Never Turn Down An Erotic Invitation To Pleasure And Here We Are, Having Sweaty, Raw Sex Reo Fujisawa

  • reo fujisawa censoredcreampiebig titsJUNYfitchnikuyokuJUNY-046JUNY046juny00046
    • 2021-10-18
    84 min

    530DG-018 ＃ 2 Female ○ Student By Convenience Store Manager ●●●● Video

  • amateur censoredcreampiebig titsdgdg-018dg018530dg-018
    • 2021-10-22
    125 min

    [ZKWD-019]After School Cum Dumpster #19, Yuzu Saijo

  • saijo yuzu censoredcreampiebig titsZKWDtoyohikozarakiyasushiun kaiZKWD-019ZKWD019zkwd00019
    • 2021-11-04
    150 min

    [SHIND-020]Stalker M"s Train Touching And Home Invasion Records #38 And 39

  • censoredamateurSHINDshinkirousuzuki o maSHIND-020SHIND020h-1560shind00020
    • 2021-11-05
    292 min

    [HUNTB-141]I"m The Only Guy At My School And Spring Cleaning Here, It"s A Panty Shot Heaven! A Panty Shot To See Everywhere You Look! 2 - This Was a Girls" School Till I Showed Up Last Year, Now I"m The Only Guy Here!

  • censoredcreampieschoolgirlHUNTBhunterkonnyaku kannohhh groupHUNTB-141HUNTB141huntb00141
    • 2021-12-10
    65 min

    529STCV-041 Mika

  • amateur censoredcreampiebig titsstcvstcv-041stcv041529stcv-041
    • 2021-12-17
    124 min

    [MIAA-543]Riding On A Horse And Squirting Out Of Control After Being Given Liquid By Her Boss Who She Hates Sex with You.

  • riho fujimori censoredcreampiebig titsMIAAmoodyzdragon nishikawaeveryone s porn starMIAA-543MIAA543miaa00543



    • Jav Cherry, watch JAV streaming online japanese xxx