jacken kodama




FC2JUFECESDMVSDHDKANATRCHRVEBODBBANLULUAPODAMBISHKDSQTEWAAAHNDSPRDMEYDDASDADNSTARS

2021-01-08
75 min

[tkwa-150]ゆい＆ちはる

  • amateur censoredcreampieuniformtkwatkwa-150tkwa150tkwa-150
    • 2021-01-16
    118 min

    [PPPD-900]Twin Sluts Surround A Hung Older Guy And Drain His Sperm Bank Dry! Tanned, Busty Nymphos Use Their Bondage SK**ls

  • censoredcreampiebig titsPPPDoppaiPPPD-900PPPD900pppd00900
    • 2021-01-29
    240 min

    [XRW-972]美少女個人撮影種付けアクメ4時間

  • hinano kanzaka toua kotone censoredcreampieXRWreal worksreal real worksXRW-972XRW972172xrw00972
    • 2021-01-30
    145 min

    [MIDE-879]Unleashed Cute, Beautiful Girl: First Time Having Creampie Sex In Her Life - Mizuki Aime

  • mizuki ai censoredcreampiesquirtingMIDEmoodyzhirokoji osakimoodyz divaMIDE-879MIDE879mide00879
    • 2021-02-08
    112 min

    460SPCY-014 [20 years old Hyogo Prefecture] Honoka

  • amateur censoredcreampieamateurspcyspcy-014spcy014460spcy-014
    • 2021-02-17
    49 min

    FC2PPV 1689875 [No] [Limited to 100 pieces 2980 → 1480pt OFF!] ♥♥ ️ Super beautiful! Raw Gonzo to Kita 〇 Keiko girls ♥ ️ Massive vaginal cum shot! !! ♥ ️ * Review benefits / Glans Zubozubo Blow

  • amateur uncensoredfc2
    • 2021-02-19
    38 min

    [BTH-120]Sluts for Rent Yuki Kami

  • yuki god censoredslutBTHchobitchchovicBTH-120BTH120h-1435bth00120
    • 2021-02-23
    120 min

    [NUBI-048]Perverted Doctors' Filthy Examinations I Was Filmed Being Felt Up In The Exam Room

  • censoredNUBIkalimantannubiaNUBI-048NUBI048h-1112nubi00048
    • 2021-02-28
    77 min

    300NTK-527 Echi Echi area development! !! H cup beauty x GAL x tide = the strongest P active women’s round begins! !! Negotiations struggle with firm greedy professional P girls! ？？ The weak point is squirting Ma Ko who is too binkan! !! The tot

  • hpnn censoredcreampiebig titsntkntk-527ntk527300ntk-527
    • 2021-02-28
    129 min

    [EMBZ-222]This Housewife Fell For A Trap Laid By An Underground Massage Parlor After Getting Slathered With Aphrodisiacs, She Got Creampie Fucked, And Then After An Aphrodisiac Oil Massage, That Fully Awakened Her Lust, And Now This Married Woman Was

  • anne mashiro censoredcreampiesingle workEMBZjukujojuku emmanuellejukujo jukuEMBZ-222EMBZ222embz00222
    • 2021-03-05
    45 min

    FC2PPV 1712131 New account start commemorative special price! Minami-chan, an active female college student model who works as a famous magazine and salon model! Early purchaser benefits will be released soon ◯◯ -chan’s original video (for purch

  • amateur uncensoredfc2
    • 2021-03-17
    120 min

    [GVH-210]A Son-in-law Going After His Mother-in-law's Too-obscene Big Tits - Mirei Fujisaki

  • misaki fujisaki censoredcreampiebig titsGVHglory questkabin kizakuraGVH-210GVH21013gvh00210
    • 2021-03-25
    76 min

    FC2PPV 1736688 [Leakage] [High-quality DL available] The darkness of the industry The whole story of a rookie AD being eaten by veteran staff is a slender body with convulsions! Stunned by vaginal cum shot [Immediately delete body]

  • amateur uncensoredfc2
    • 2021-03-27
    120 min

    [KSBJ-127]Spartan Sex Education From Intellectual Stepmoms Satomi Suzuki

  • satomi suzuki censoredcreampieblowjobKSBJksb kikaku emmanuellebito sakuraKSBJ-127KSBJ127ksbj00127
    • 2021-03-30
    104 min

    [311AXDVD-0288R]奴●の恋人 2 宙刷り・火焔・鞭・蝋燭・浣腸

  • amateur censoredamateurbdsmaxdvdaxdvd-0288raxdvd0288r311axdvd-0288r
    • 2021-04-02
    145 min

    [JBD-265]S********l Snake Tied - G*******g 14 Erena Takeda

  • elena takeda censoreduniformsingle workJBDattackershana kanojabakuJBD-265JBD265jbd00265
    • 2021-04-02
    145 min

    [JUL-533]Getting Fucked Over And Over By My Son's Uncontrollable Friend Yuko Shiraki

  • shiraki yuko censoredbig titsmature womanJULmadonnaamazing meatJUL-533JUL533jul00533
    • 2021-04-09
    148 min

    [EBOD-815]120 Service: Whether It's Sex Or Her Work, This Curvy I-Cup Gives It Her Best - Busty Clerk At A Burger Shop Riku Serina

  • serina riku censoredbig titssquirtingEBODe bodymichiru arashiyamaEBOD-815EBOD815ebod00815
    • 2021-04-09
    141 min

    [IPX-639]20 Days Without Sex X Aphrodisiac That Makes Her Piss - Lust Driven To Its Limits... Pounded Hard, Then Pounded More! Hikari Azusa

  • azusa hikari censoredbig titssquirtingIPXidea pocketdishIPX-639IPX639ipx00639
    • 2021-04-15
    97 min

    435MFC-098 [G Cup & Big Ass Beautiful Female College Student] Reiwa’s Best Pure Girl And First Gonzo Declaring "I Only Want To Etch With My Favorite People"! Obscene pie bread that gets soaked from the beginning despite the fact that

  • amateur censoredcreampiebig titsmfcmfc-098mfc098435mfc-098
    • 2021-04-18
    125 min

    [OPKT-029]Forbidden Pregnancy OK: Creampie Part-time Job Meg

  • censoredcreampiesquirtingOPKTtoyohikotoyohikotoyohiko kikakuOPKT-029OPKT029opkt00029
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-20
    158 min

    [DANDY-765]I'm On The Last Train Home, And To My Surprise, Me And This Slut Are The Only Ones On Board! She Was Sitting Across From Me, Flashing Panty Shot Action And The Temptation Of Her Beautiful Legs Gave Me A Serious Erection, And I Was Done

  • censoredslutDANDYdandybacon tanakaDANDY-765DANDY7651dandy00765
    • 2021-05-20
    20 min

    HEYZO 2529 Yu’s Orgasms with Toys – Yu Sakuma

  • yu sakuma uncensoredblowjobheyzo
    • 2021-05-25
    55 min

    FC2PPV 1835787 Kimi, it’s almost like letting me be youth like this 2 ♪ Rokuki Layer-san Nakashi Nakashibe Echiechi Unipaisen Part2

  • amateur uncensoredfc2
    • 2021-06-04
    150 min

    [JUL-608]My Friend's Mother Is A Prim And Proper Prude Yuko-san Turned Out To Be A Super Horny Bitch Who Will Suck My Semen So Hard My Balls Went Dry ... Yuko Shiraki

  • shiraki yuko censoredbig titsmature womanJULmadonnabieber gonzoJUL-608JUL608jul00608
    • 2021-06-06
    60 min

    318LADY-375 Ai

  • amateur censoredamateurladylady-375lady375318lady-375
    • 2021-06-10
    85 min

    413INST-129 [Again, the voice actor world! ] LoveLa ● Bu! !! Photo session with an active idol 20 years old A ridiculous secret personal photo session that recorded a closed room hotel outflow, convulsions Iki thrust into a vibe pussy, and ahegao con

  • amateur censoredcreampieamateurinstinst-129inst129413inst-129
    • 2021-06-20
    256 min

    [NSFS-006]My Husband Is Not Enough: Married WOmen Inviting Men - Best Edition

  • momose yuri sumire seto censoredmarried womanmature womanNSFSnagae styletaro fujoNSFS-006NSFS006nsfs00006
    • 2021-06-20
    181 min

    [DOKI-014]The Escort I Called Ended Up Being An Old Acquaintance, So I Convinced Her To Let Me Fuck Her Raw And Cum Inside Of Her! 180 Minutes

  • censoredcreampiebig titsDOKIstar paradisedokiDOKI-014DOKI014h-254doki00014
    • 2021-07-02
    65 min

    520SSK-015 Miharu

  • amateur censoredcreampieamateursskssk-015ssk015520ssk-015
    • 2021-07-08
    123 min

    [DLDSS-017]The Queen of Kinshicho: The Hostess's Sexual Servicing of Customers Through Cum Swallowing and Creampies Ayaka Tomoda

  • ayaka tomoda censoredblowjobslutDLDSSdahliajounetsu yakaraDLDSS-017DLDSS0171dldss00017
    • 2021-07-14
    65 min

    FC2PPV 1921054 [Complete Amateur 113] Con 19 Years Old Part 2, Complete Appearance, Popular S-class Beautiful Girl Clothes Bondage Sex!

  • amateur uncensoredfc2
    • 2021-07-14
    119 min

    [JYMA-012]She Tempts Men With Her Voluptuous, Sexually Frustrated Body: A Married Masochistic Slut With A Freaky Sex Drive, A Plump Body, Colossal J Cup Jugs And A Thick Ass, Ready To Get Teased And Cum Over And Over

  • censoredcreampiebig titsJYMAjukujo ha tsurai yobuddha dmanji groupJYMA-012JYMA012jyma00012
    • 2021-07-17
    118 min

    [NNPJ-459]Picking Up Girls: Landing A Nordic Amateur And Taking Her Back To A Hotel Room To Fuck... Mind-Blowingly Gorgeous Body And Incredible Sex Skills. "Do You Want Me？ (Wanna Do It？)"

  • censoredblowjobNNPJnanpa japanNNPJ-459NNPJ459nnpj00459
    • 2021-07-23
    127 min

    [VEO-045]Appearing September, Makuhari Messe, Akihabara UDX, and many other Festival Events...Real Celebrity, Former Idol, AV DEBUT!! Misakura Ishikawa

  • misakura ishikawa censoredcreampiemature womanVEOvenuskaniebornVEO-045VEO045veo00045
    • 2021-07-27
    97 min

    464STST-020 Rin

  • amateur censoredamateurbeautiful girlstststst-020stst020stst-020
    • 2021-08-10
    133 min

    [HSM-031]Trap Graduation. Hime.love Yume Kobayashi -Crossdresser"s Last Fuck Is A Creampie-

  • censoredamateurHSMhime styleHSM-031HSM03159hsm00031
    • 2021-08-25
    81 min

    435MFC-135 [The Strongest De S Queen In History X Ejaculation Management De M Man] I Will Not Forgive If I Get It Without Permission! Beautiful Breasts Nice Bottom Reira-Sama And De M Tickle Your Heart Life-Killing Metamorphosis Sex ♪ Gun Attack By T

  • amateur censoredcreampieamateurmfcmfc-135mfc135435mfc-135
    • 2021-09-02
    44 min

    494SIKA-103 Electric Machine For The First Time! Naive Small Breasts J ○ Is The First 3p With A Big Cock Actor!

  • amateur censoredschoolgirlamateursikasika-103sika103494sika-103
    • 2021-09-04
    120 min

    [KSBJ-155]Adultery At Home, Behind My Husband"s Back. Amu Hanamiya

  • hanamiya amu censoredslutsingle workKSBJksb kikaku emmanuellesakura ninKSBJ-155KSBJ155ksbj00155
    • 2021-09-08
    59 min

    416SVMM-053 Ruri

  • amateur censoredanalcreampiesvmmsvmm-053svmm053416svmm-053
    • 2021-09-23
    121 min

    [SW-801]About To Get Ready For Masturbation When A Nurse Comes In To Intrude!？ My Balls Are So Full That My Dick Just Can"t Take It. Her Huge Ass Drives Temptation, And This Lewd Nurse Is Just Delighted To Take Massive Loads Of Cum!

  • censorednurseSWswitchcambridgeswitch hibinoSW-801SW8011sw00801
    • 2021-09-24
    477 min

    [OFJE-330]Marin Hinata 2nd Anniversary Memorial BEST: Newest 10 Titles, 8 Hours, Special

  • marin hinata censoredbig titssquirtingOFJEs1 no 1 styleOFJE-330OFJE330ofje00330
    • 2021-10-01
    120 min

    [HODV-21611]My Husband Doesn"t Ever Want To Fuck Me, Now My Terrible Younger CEO At Work Takes Me In For Dominant Sex. NTR Cheating Scenario. Mizuki Yayoi

  • mizuki yayoi censoredcreampiebig titsHODVh m pvotomsHODV-21611HODV216115642hodv21611
    • 2021-10-13
    91 min

    546EROF-002 [Leaked] K Cup Gravure Private Co-Star And Gonzo Sex (Ena Koume)

  • amateur censoredbig titsamateureroferof-002erof002546erof-002
    • 2021-10-18
    66 min

    530DG-019 ＃ 3 Female ○ Student By Convenience Store Manager ●●●● Video

  • amateur censoredcreampiebig titsdgdg-019dg019530dg-019
    • 2021-11-01
    120 min

    [NACR-474]Hyposexual Suggestion. Beautiful Wife Manipulated By Neighbor Aoi Mizutani

  • aoi mizutani censoredcreampieblowjobNACRplanet plussakura ninshichi ku ryuuNACR-474NACR474h-237nacr00474
    • 2021-11-06
    145 min

    [SE-201]Good Morning C*cks! The Return Of The Amateur Hooker Creampie A Real-Life College Girl! Our Beloved, Beloved Sara Kagami A Sadistic, Silky Smooth (I Have A Shaved Pussy ...) Shitty Lady Boss Was Such A Super Selfish Bitch When It Came to Sex

  • censoredSEpuramutoukousha akirashirouto only plumSE-201SE20184se00201
    • 2021-11-08
    63 min

    FC2PPV 2414728 Up To 15 2180 [No] Fair-Skinned Slender Active University Student. He Feeds Frankfurt To A Female Hole, Plays As Much As He Wants With A Female Body, And Continuously Vaginal Cum Shot.

  • amateur uncensoredfc2
    • 2021-11-12
    45 min

    480FRIN-058 [51 Years Old Shinagawa Store] Back Op Negotiations With A Mature Masseuse, Hidden Shooting Raw Squirrel Video

  • amateur censoredcreampiemarried womanfrinfrin-058frin058480frin-058
    • 2021-11-13
    120 min

    [AUKG-526]The Neighbors" Daylight Adultery, A Lesbian Series, Yuri Sasahara, Natsuki Takeuchi

  • yuri sasahara natsuki takeuchi censoredlesbiandramaAUKGu krentoAUKG-526AUKG526aukg00526
    • 2021-11-19
    119 min

    [MBDD-2063]Rin Natsuki / As Rin

  • rin natsuki censoredbeautiful girlsingle workMBDDmedia brandMBDD-2063MBDD2063301mbdd02063
    • 2021-11-20
    220 min

    [NATR-669]Marumaru Series! Kimika Ichijo

  • mika ichijo censoredcreampiebig titsNATRnadeshikoNATR-669NATR669natr00669
    • 2021-11-29
    46 min

    FC2PPV 2473476 [Personal Shooting / Creampie] A 33-Year-Old Mature Wife Who Knows The Taste Of Ji Po Other Than Her Husband And Is Addicted To It "I Want To Be Satisfied As A Woman …"

  • amateur uncensoredfc2
    • 2021-12-04
    64 min

    SIRO-4716 [First Shot] [White Skin Slender] [Upper Eye-Catching Service] An Active JD Who Attends The Faculty Of Law Has Appeared. A Young Man Who Likes Uncle Makes A Cute Face Caress And Sucks A Penis With A Slender Body .. AV Application On The Net

  • amateur censoredamateursirosiro-4716siro4716siro-4716



    • Jav Cherry, watch JAV streaming online japanese xxx