incest big butt censored javcensored creampie




FC2PPPDDASDJULKBIGVHPREDHZGDMVSDVENUHDKADTTMEYDSSISWAAAAVSADASDGMEMMIAASSNINNPJ

2020-09-18
38 min

FC2PPV 1506489 Sale period discount-800 Super beautiful girl Fukaon-like height 145 cm Small but beautiful breasts with a good body blame favorite gal and vaginal cum shot 2nd round gal ⑬

  • amateur uncensoredfc2
    • 2020-09-21
    118 min

    [XVSR-555]Bubble Princess Heaven - Beautiful Girl At A Soapland That You Can Totally Give Your Creampie Hikaru Konno

  • hikaru konno censoredcreampiebeautiful girlXVSRmax ashanty yazawacalenXVSR-555XVSR555xvsr00555
    • 2020-09-28
    79 min

    [JFIC-018]Beautiful Legs And A Beautiful Ass Sena Amatsuka

  • angel senna censoredsingle workJFICnctrJFIC-018JFIC0185141jfic00018
    • 2020-10-09
    64 min

    SIRO-4270 [First shot] [Baby-faced beautiful girl] [God legs] I’m too embarrassed to cry .. A beautiful girl who loves delusions. A series of inexperienced pleasures that can not be obtained by delusion completely turned into a female face ̷

  • amateur censoredamateurbeautiful girlsirosiro-4270siro4270siro-4270
    • 2020-10-18
    104 min

    [DDT-639]Completely Tied Up - Agonizing Ecstasy Kanade Tsuchiya

  • kana tsuchiya censoredcreampiedeepthroatDDTdogmatohjiroDDT-639DDT639ddt00639
    • 2020-10-28
    49 min

    FC2PPV 1549507 ★ Appearance ☆ Follower amateur man and erotic older sister Midoriko cum shot for the first time ☆ Grinning Midoriko looking at Bing’s big dick ♥ A large amount of semen cum shot at the end while squirming to the back of the vagin

  • amateur uncensoredfc2
    • 2020-10-29
    47 min

    [oretd-786]SENA

  • amateur censoredcreampieuniformoretdoretd-786oretd786oretd-786
    • 2020-11-13
    50 min

    [CRNX-009]Realizing They Are Sexless...Older Men Have The Second Taste Of Sex In Their Life Vol.3 Aoi Kururugi

  • aoi kururugi censoreduniformblowjobCRNXcrystal picturekintaro okumacrystal nextCRNX-009CRNX00949crnx00009
    • 2020-11-17
    46 min

    330PER-335 Ema 2

  • amateur censoredamateurperper-335per335330per-335
    • 2020-11-28
    138 min

    [IKST-003]Outstanding Amateur - Kindly Cutie With Colossal Tits! Light Skin, Black Hair, Divinely Endowed Babe

  • censoredbig titsamateurIKSTsuddenly eroticIKST-003IKST003h-1454ikst00003
    • 2020-11-29
    96 min

    [VEC-454]My Mom's Best Friend Misa Kuroki

  • misa kuroki censoredcreampiebig titsVECvenusbingo tamatsukamegami venusVEC-454VEC454vec00454
    • 2020-12-05
    236 min

    [TSP-436]Corrupted By Pleasure Before She Knew It. Horny College Professor "Teacher, My Pussy Is Throbbing..."

  • censoredcreampieTSPtokyo specialmanji groupTSP-436TSP436tsp00436
    • 2020-12-09
    22 min

    10musume 120920_01 Secret Pussy Collection: Makoto Kakizawa

  • amateur uncensored10musume
    • 2020-12-12
    171 min

    [IPX-573]FIRST IMPRESSION 146 Amu Amatsuka

  • amatsuka amu censoredsquirtingbeautiful girlIPXidea pocketkyoseidishIPX-573IPX573ipx00573
    • 2020-12-17
    92 min

    435MFC-064 Aimi

  • amateur censoredcreampiesquirtingmfcmfc-064mfc064435mfc-064
    • 2020-12-24
    120 min

    [HBAD-568]My Fair-Skinned Wife - Healthy Bride Offers Herself To Her Husband's Bosses In His Place Mahoro Kamiki

  • mahoro kamiki censoredblowjobsingle workHBADhibinonamitaro umababeHBAD-568HBAD5681hbad00568
    • 2020-12-31
    160 min

    [BF-624]I Moved Towns For Work And Now My Landlord's Wife Is Trying To Seduce Me - I Ended Up Giving Her My Creampie... Ai Mukai

  • ai mukai censoredcreampieslutBFbefreeroku yonBF-624BF624bf00624
    • 2021-01-12
    172 min

    1Pondo 011221_002 The Best 10 Of 2020: From 2 To 5 Risa Onodera Emi Aoi Mirai Hanamori Saori Miyazawa

  • amateur uncensored1pondo
    • 2021-01-14
    62 min

    230OREC-669 Hikari

  • amateur censoredcreampieamateurorecorec-669orec669orec-669
    • 2021-01-14
    63 min

    336KNB-137 A sad new wife who is sexless even though she is newly married appears on AV! Excellent sensitivity! It blooms disorderly so as to radiate sexual desire that can not be satisfied by my husband! !! I will take a gonzo with this married woma

  • amateur censoredmarried womansquirtingknbknb-137knb137336knb-137
    • 2021-01-16
    59 min

    10musume 011621_01 Not Wearing Make up Amateur : Look At My No Makeup Ordinary Face Masako Sawamura

  • amateur uncensored10musume
    • 2021-02-01
    91 min

    [MMRAA-181]山崎水愛 キミを忘れない～山崎水愛卒業作品～

  • yamasaki mia censoredsoloworkMMRAAspice visualMMRAA-181MMRAA181
    • 2021-02-06
    101 min

    390JAC-080 [18-year-old G huge breasts GAL x 3 vaginal cum shot facial cumshots] GIRIGIRI Chop barely 18 years old! It’s like a sun-shaped angel! Ultra Soul Pichi GAL! Creampie phantom from sometime cum clitoris! Next notice “GAL is staring

  • amateur censoredcreampiebig titsjacjac-080jac080390jac-080
    • 2021-02-12
    82 min

    FC2PPV 1683384 Fair-skinned H cup big breasts girl ❤️ messed up the popular Sora with Lady Gras and fired 2 consecutive times ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-03-01
    120 min

    [NACR-405]A Father-in-law Who Fell In Love With His Son's Wife - Nozomi Higashi

  • nozomi higashi censoredcreampiemature womanNACRplanetshichidomeNACR-405NACR405h-237nacr00405
    • 2021-03-14
    116 min

    421OCN-020 Yukki

  • amateur censoredcreampieamateurocnocn-020ocn020421ocn-020
    • 2021-04-03
    127 min

    [SORA-305]"Look At My Shameful Body" Perverted Masochistic Slut Is Open For Business! Momo Hazuki

  • hazuki peach censoredsingle workSORAyama to soratrippyySORA-305SORA305sora00305
    • 2021-04-07
    93 min

    435MFC-095 [Latest Reiwa Female College Student] Full-spec female college student with beautiful big tits, beautiful girl and cute voice and Icharab SEX 2nd round! Gonzo is a little embarrassing, but if it is inserted, it will move around without any

  • amateur censoredcreampiebig titsmfcmfc-095mfc095435mfc-095
    • 2021-04-27
    51 min

    H0930 ki210427 Yuko Tominaga 31years old

  • amateur uncensoredh0930
    • 2021-05-07
    50 min

    Caribbeancom 050721-001 3 vaginal cum shots to yukata beauty Emi Aoi

  • emi aoi uncensoredcreampiehandjobcaribbeancom
    • 2021-05-07
    480 min

    [DRC-017]【期間限定販売】シロウト娘ナンパ狩り！！ 貴女はいくらでラブホまで来てくれますか！？ 8時間 03

  • amateur censoredamateurdrcdrc-017drc017drc-017
    • 2021-05-21
    67 min

    SIRO-4531 [First shot] [World standard half ass] [Latin cowgirl] Big ass of a half beautiful woman who undulates like an invitation. Shake yourself to a meat stick other than your first boyfriend and roll it up .. AV application on the net → AV exper

  • amateur censoredamateursirosiro-4531siro4531siro-4531
    • 2021-06-04
    67 min

    328HMDN-368 [Married Woman / Personal Shooting] Hairdresser / Married Woman 28 Years Old A Nasty Woman Who Cheating With Her Husband’s Brother Climaxes An Innocent Body That Doesn’t Stop! Sensitive pussy keeps squirting!

  • amateur censoredcreampiemarried womanhmdnhmdn-368hmdn368328hmdn-368
    • 2021-06-05
    63 min

    SIRO-4518 [First shot] [Healing beautiful girl JD] [Natural sticky butt] Beautiful girl college student with 100 purity. Although she is shy, she can not resist her pleasure and asks for a meat stick many times while moistening her eyes .. AV applica

  • amateur censoredamateurbeautiful girlsirosiro-4518siro4518siro-4518
    • 2021-06-15
    58 min

    FC2PPV 1870587 ★ First shot amateur ☆ Perverted beauty with a desire to be fucked by vaginal cum shot ♥ Ayana-chan 24 years old ☆ Shaved Moriman ♥ Best blowjob ♥ Lustful raw squirrel ♥ Creampie prepared for pregnancy ♥ [Individual shooting] Benefits

  • amateur uncensoredfc2
    • 2021-06-24
    118 min

    [MILK-112]I Love Older Men I'll Cover You In Sloppy Wet Kisses Coed Slut Mao Watanabe

  • mao watanabe censoreduniformschoolgirlMILKmilkMILK-112MILK112h-1240milk00112
    • 2021-06-25
    129 min

    [ECB-146]Man, Stop Being A Cherry Boy. Miho Tono

  • miho tsuno censoredblowjobsingle workECBwaap entertainmentkurumi ichinosecobra warpECB-146ECB1462ecb00146
    • 2021-07-04
    39 min

    016DHT-0275 Former Taxi Female Driver ~ Confession True Story Drama ~ Toko Saeki

  • amateur censoredcreampieamateurdhtdht-0275dht0275016dht-0275
    • 2021-07-20
    181 min

    [STARS-404](3 Rounds Of Incredible, Orgasmic Sex With An Erotic Woman In Her Forties) SODstar Mariko Sada 42 Years Old Deflowering The Unrivaled Eroticism Of An Adult Woman

  • mariko sada censoredmature womansingle workSTARSsod createeasy matsumotosod starSTARS-404STARS4041stars00404
    • 2021-07-22
    72 min

    [inst-141]ここな＆まみ

  • amateur censoredcreampieamateurinstinst-141inst141inst-141
    • 2021-08-20
    240 min

    [MISM-209]A Secretary"s Craziest Deep Throat: A W Throat Cavity Dedication SP. Aya Shiomi, Mio Ichijou.

  • aya shiomi ichijo mio censoredMISMemumusume labblack heart loveMISM-209MISM209mism00209
    • 2021-08-31
    131 min

    [KIRE-055]"Please Touch Me More" Wife Becomes Lewd At Hot Spring After Chugging Seaya Ichinose Aged 37

  • ichinose ayano censoredmarried womansoloworkKIREsod createinugami ryourei kirei sodKIRE-055KIRE055
    • 2021-09-09
    120 min

    [FSDSS-312]Reborn Debut Her Amazing And Shimmering Top-Class Waist Between Her Beautiful Tits And Ass. Ruru Amakuni

  • heave censoredcosplayFSDSSfalenoboomer 44faleno starFSDSS-312FSDSS3121fsdss00312
    • 2021-09-11
    98 min

    [XRL-023]A Debt-stricken Stepdad Training His Stepdaughter To Become A Sex Toy - Erena Takeda

  • elena takeda censoredsquirtingsingle workXRLk m producereal real worksXRL-023XRL023xrl00023
    • 2021-09-24
    240 min

    [REXD-385]That Woman... She Made Such A Fool Of Me... I Want To Take Revenge... For What She Did To Me...

  • censoredcreampieREXDredgroupREXD-385REXD385rexd00385
    • 2021-09-25
    70 min

    FC2PPV 2203916 For A Limited Time [Stealing X Shooting] Appearance: Big Breasts J ● Daddy Live Dashcam Data Leaked Toshima Ward [Car Sex]

  • amateur uncensoredfc2
    • 2021-10-08
    154 min

    [SSIS-178]Mixed Body Fluids, Deep Sex: A Completely Uncut Special. Subaru Wachi

  • wachi subaru censoredbig titsbeautiful girlSSISs1 no 1 stylemonSSIS-178SSIS178ssis00178
    • 2021-10-14
    57 min

    299EWDX-385 Nipples Stand Up Too Much! A Delicate Body That Seems To Break! A Famous Instrument! Creampie!

  • amateur censoredcreampiemarried womanewdxewdx-385ewdx385299ewdx-385
    • 2021-11-05
    179 min

    [DASD-935]Continuing to be Sexually Developed by a Playboy, My Neat and Clean Girlfriend Became a Convenient Fuck-Buddy. Chiharu Miyazawa

  • chiharu miyazawa censoredblowjobsingle workDASDdasmasaki naoDASD-935DASD935dasd00935
    • 2021-11-13
    85 min

    355OPCYN-196 Yuuri (Yuri Asada)

  • amateur censoredcreampiesquirtingopcynopcyn-196opcyn196355opcyn-196
    • 2021-11-13
    210 min

    [KDMI-040]Girls in High Cut Leotards. Suite. Amazing.

  • akari shinmura miina wakatsuki censoredslutKDMImiruyumeno aidaKDMI-040KDMI040kdmi00040
    • 2021-11-15
    137 min

    [ZEX-409]G Cup Temptation Body Kanade Best

  • freedom censoredcreampiebig titsZEXpeters maxpi ta zu maxZEX-409ZEX409h-720zex00409
    • 2021-12-01
    127 min

    [NACR-484]Going Squeeze Out Cum Until Your Balls Are Dry! Business Trip Oil Massage! Noa Miura

  • miura noai censoredcreampiebig titsNACRplanet plushimu locknanakuruNACR-484NACR484h-237nacr00484
    • 2021-12-02
    103 min

    FC2PPV 2482925 [Thank You For Selling 250 Bottles! Limited Number Of 1980] A Girl At Nogizaka Level At The Age Of 18. She Leaked Without Permission. She Ejaculates In A Famous Idol Pussy And Regurgitates A Large Amount Of Sperm. In Addition, She Shot

  • amateur uncensoredfc2
    • 2021-12-24
    116 min

    [VAGU-242]The Female Boss Who Became A Mannequin To Handle A Complaint - Reishi No Mannequin Madame Gaiden - Miyu Tsubakihara

  • miyu tsubakihara censoredcreampiemature womanVAGUvenuspeterultimaVAGU-242VAGU242vagu00242



    • Jav Cherry, watch JAV streaming online japanese xxx