housewife squirting big tits censored creampie




FC2GVHSSNIROYDAMBIAVSAMIDVCAWDMARASANMILKADNNNPJABWATIDNGODMIAAVEMAHUNTBRBDSSIS

2020-12-08
59 min

345SIMM-569 Home affair where a model married woman twists a slender body and devours another stick

  • amateur censoredcreampiemarried womansimmsimm-569simm569345simm-569
    • 2020-12-09
    44 min

    374SHOW-039 Tsukino

  • amateur censoredbig titsamateurshowshow-039show039374show-039
    • 2020-12-12
    20 min

    FC2PPV 1603890 Planning to verify the tech of amateur men Bonus infiltrates an adult party 210 minutes

  • amateur uncensoredfc2
    • 2020-12-17
    118 min

    [SSNI-948]Hotel Room Adultery - Boss Nails His Employee All Night Long - Cheating On A Business Trip Sayaka Otoshiro

  • otoshiro sayaka censoredbeautiful girlsingle workSSNIs1 no 1 stylebungo maedaSSNI-948SSNI948ssni00948
    • 2020-12-20
    119 min

    [CJOD-274]No Inches Overlooked! Limitless Loads Blown At A Men's Massage Parlor! Includes Complementary Dry Orgasm Service, And Of Course Creampie Sex Is A-OK! A Full Course Of Treatments For Your Cock Tsubasa Hachino

  • yano tsubasa censoredcreampiebig titsCJODchijo heaventaro ryogokuCJOD-274CJOD274cjod00274
    • 2020-12-25
    54 min

    10musume 122620_01 Make an amateur girl come until you she say a tongue twister Takako Kumada

  • amateur uncensored10musume
    • 2020-12-26
    69 min

    200GANA-2398 Seriously Nampa, first shot. 1574 Succeeded in bringing an idol-class beautiful girl to a hotel in Nippori, which has a retro feel to downtown! !! If you do not have a boyfriend’s sexual desire and you are sexless, you will complain

  • amateur censoredsquirtingamateurganagana-2398gana2398200gana-2398
    • 2021-01-01
    55 min

    [PARATHD-3082]Saki Hatsumi Is Suddenly Visiting The Home Of A Cherry Boy And Giving Him A Cherry-Popping Good Time

  • hatsumi saki censoredblowjobPARATHDparadise tvPARATHD-3082PARATHD3082parathd03082
    • 2021-01-02
    101 min

    390JAC-072 [Tall sperm lover GAL x 4 vaginal cum shot] Happy New Year! Happy New Year, this year is again GAL’s favorite Jackson! The top batter in Reiwa 3 years is tall! Slender! I like sperm! Foot peen cramps climax immediately Dokan! In addit

  • amateur censoredcreampiesquirtingjacjac-072jac072390jac-072
    • 2021-01-04
    240 min

    [C-2607]Day-Trip Hot Spring - A MILF's Lusty Journey - The BEST Collection 2019.06-2020. 04

  • censoredCgogosgogo s coreC-2607C2607140c02607
    • 2021-01-08
    79 min

    300NTK-497 Convulsions Sensitive Prickets Beautiful Girl Get Drunk Continuous Ascension! !! If you get drunk with a geki piss and hit Nuru Kanzake, you will feel the pressure in the vagina as it shakes. !! The more I drink sake, the more Ichacola SEX

  • amateur censoredcreampieamateurntkntk-497ntk497300ntk-497
    • 2021-01-26
    139 min

    [KIRE-022]"My Husband Might Ask Me, 'Did Something Good Happen Today？ ...'" A Day Filled With 9 Adultery Fucks In A Super Orgy Of Illicit Sex Sumire Kurusu

  • sumire kurusu censoredlingeriesingle workKIREsod createkurenai katobeauty kirei sodKIRE-022KIRE0221kire00022
    • 2021-01-29
    15 min

    490FAN-095 Asahi

  • amateur censoredamateurblowjobfanfan-095fan095fan-095
    • 2021-02-06
    122 min

    [JUL-470]Close-up Sex: Unfaithful Guidance, Drowning In Carnal Desire For My Son's Homeroom Teacher - Reiko Kobayakawa

  • kobayakawa reiko censoredbig titsmature womanJULmadonnarokusaburo mishimaJUL-470JUL470jul00470
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-19
    124 min

    [MOPG-068]I'd Love It If That Slut Teased My Nipples While She Choked Me. Ayaka Muto

  • ayaka muto censoredhandjobnurseMOPGm man paradisemo goldMOPG-068MOPG068mopg00068
    • 2021-02-23
    58 min

    FC2PPV 1698424 [No appearance] The strongest lo ● Big breasts Shaved girl pregnant confirmed raw vaginal cum shot Every time I poke my uterus because I am too sensitive, Ikuiku continuous call Ikuiku consecutive calls Unauthorized gachinko conceived

  • amateur uncensoredfc2
    • 2021-02-25
    23 min

    HEYZO 2468 Erotic Massage for Yuki – Yuki Sasaki

  • yuki sasaki uncensoredblowjobcumshotheyzo
    • 2021-02-26
    48 min

    [MASE-015]Horny Older Women 33 Year Old Hotaru Big Mature H Cup Titties And Curvy Body Arching Backs And Raw Fucking! Hotaru Mori

  • hotaru mori censoredcreampiebig titsMASEcrystal picturemadam maniac plusMASE-015MASE01549mase00015
    • 2021-03-02
    201 min

    [SDNM-269]New Mother Cums By Having Her Titties Teased And Sucked Azumi Suzuhara 27 Years Old Porno Debut

  • azumi suzuhara censoredmomsingle workSDNMsodtanaka baconrealSDNM-269SDNM2691sdnm00269
    • 2021-03-06
    160 min

    [JUL-494]Teased... Teased... Teased... And Teased Again... Penetrated At The Moment She's Wettest - Adultery With A Soaking Pussy. Nao Jinguji

  • jinguji temple nao censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-494JUL494jul00494
    • 2021-03-09
    81 min

    300NTK-532 Sakaike Meat Forest 4P Echi Echi Unmanned piston at the demon cowgirl of a carnivorous gal! !! Simultaneous insertion of raw chin in the scene with W Blow from cunnilingus only in the gal juice due to the ruckus of drinking and rubbing in

  • maxjdh censoredcreampieamateurntkntk-532ntk532300ntk-532
    • 2021-03-19
    63 min

    [sika-053]みか(18)

  • amateur censoredschoolgirlamateursikasika-053sika053sika-053
    • 2021-03-30
    54 min

    402MNTJ-051 Ray (21)

  • amateur censoredamateurmntjmntj-051mntj051402mntj-051
    • 2021-04-01
    118 min

    [AMBI-122]My Secret Married Love Life With My Homeroom Teacher Ichika Matsumoto

  • ichika matsumoto censoreduniformschoolgirlAMBIplanet plusdirector oanbibaresotsuAMBI-122AMBI122h-237ambi00122
    • 2021-04-07
    93 min

    435MFC-095 [Latest Reiwa Female College Student] Full-spec female college student with beautiful big tits, beautiful girl and cute voice and Icharab SEX 2nd round! Gonzo is a little embarrassing, but if it is inserted, it will move around without any

  • amateur censoredcreampiebig titsmfcmfc-095mfc095435mfc-095
    • 2021-04-08
    18 min

    FC2PPV 1760080 [Ochinpo Shine / Kurairi Series ④] I was begged by a tall volleyball girl, so I made a raw fuck and a large amount of vaginal cum shot! ？？ 2nd ① Creampie [Karen-chan] Blow specialization

  • amateur uncensoredfc2
    • 2021-04-09
    137 min

    [SABA-690]Sharing A Hotel Room With My Coworker After We Went Out And Missed The Last Train... She Seemed So Unguarded, I Couldn't Resist Her... vol. 007

  • censoredcreampieuniformSABAskyu shirototodoSABA-690SABA690saba00690
    • 2021-05-15
    139 min

    [TIKB-108][Godly Times] A Video Of A Girl With Glasses And Colossal Tits Who Gets Into The Sugar Daddy Lifestyle By Luring Men With Lewd Videos Of Herself Posted on Websites

  • censoredcreampiebig titsTIKBtikitiki.comerTIKB-108TIKB108tikb00108
    • 2021-05-15
    233 min

    [BANS-001]Nihao Saiko 1

  • censoredschoolgirlBANSnihao the best daydream tribeBANS-001BANS001bans00001
    • 2021-05-21
    177 min

    [HND-986]Fresh Face: Female Bartender With Strong Sex Drive Follows Her Classmate Who Became A Porn Star: Her Real Creampie Debut!! Remi Matsushima

  • remi matsushima censoredcreampieblowjobHNDhon nakayurukoHND-986HND986hnd00986
    • 2021-05-23
    118 min

    420POW-003 Osuzu [Talent activity / Big breasts Lori / Big butt / Beautiful skin / Climax] The impeccable dirty body is praised by users! A beautiful girl with huge breasts who has been scouted in a local city and is currently active as a talent! Sha

  • amateur censoredbig titsuniformpowpow-003pow003420pow-003
    • 2021-05-27
    68 min

    FCP-019 [Delivery only] << Completely subjective >> Your Ji-Po will definitely be pulled out …! Only handjob won! Beautiful girl handjob!

  • amateur censoredbig titsamateurfcpfcp-019fcp019fcp-019
    • 2021-05-29
    36 min

    FC2PPV 1841887 [Graduation from Cum Swallowing] Blow-free Olympics with cleaning, cum swallowing, and G fucking. I used my technique to squeeze sperm [4K bonus video available]

  • amateur uncensoredfc2
    • 2021-06-03
    60 min

    336KNB-157 Coming Out The Narrowness Of The Vagina! My husband doesn’t fit in well and it’s not cool! If you are a professional, please make a mistake! !! A lewd wife who is disturbed by a series of climaxes with a pleasant sensation that I

  • amateur censoredmarried womanamateurknbknb-157knb157336knb-157
    • 2021-07-17
    116 min

    [NNPJ-461][Amateur Rough Sex Shot] We Turned A Recorded Video Of A Female S*****t Getting Impregnated Into An AV (20 Years Old)

  • censoredcreampiebeautiful girlNNPJnanpa japanNNPJ-461NNPJ461nnpj00461
    • 2021-07-24
    71 min

    SIRO-4602 [First Shot] [SSS Class Super Sensitive Body] [Endless Squirting] A Talented Material That Combines The Best Sensitivity With The Best Body Has Appeared. While Fascinating A Technique That Does Not Seem To Be 21 Years Old, She Happily Licks

  • amateur censoredsquirtingamateursirosiro-4602siro4602siro-4602
    • 2021-07-30
    93 min

    300NTK-613 [Pecan! !! 3 Beautiful Girls! !! All Innocent Bitch! !! Gangbang "6P" Special! !! ] Exactly Sake Pond Meat Forest! !! Beautiful Girl X 3 People! !! All The Miraculous Three Sexes Called De Nasty Dovich Gather Under The Clear Sky An

  • amateur censoredcreampiesquirtingntkntk-613ntk613300ntk-613
    • 2021-08-31
    61 min

    HEYZO 2603 Get Laid With A Busty Beauty At Premium Soapland Vol.2 – Asaka Sera

  • asaka sera uncensoredcreampiehandjobheyzo
    • 2021-09-04
    71 min

    200GANA-2548 Seriously Nampa, First Shot. 1684 If You Were Distributing Uchiwa For Free In Shibuya, You Succeeded In Picking Up A Baby-Faced Beautiful Girl JD! The Delicate Body Is Violently Embraced By The Big Cock Actor And Trembles With Pleasure!

  • amateur censoredamateurganagana-2548gana2548200gana-2548
    • 2021-09-18
    112 min

    [MRSS-120]My Wife Mistakenly Walked Into The Neighbour"s House And Had Sex With A Stranger Hibiki Otsuki

  • otsuki sound censoredcreampiebig titsMRSSmisesu no sugao emanuelyumesaki ichiroumisesu no sugaoMRSS-120MRSS120mrss00120
    • 2021-09-19
    51 min

    [091921_01][VR] 囁く般若ギャル

  • amateur uncensored10musume
    • 2021-09-24
    12 min

    FC2PPV 2244020 [Reading Attention! !! ] Goods ● Jogakuin ③ Year: Big Breasts Archery Member Ikase Hell. Outflow At Summer Training Camp [Limited Quantity]

  • amateur uncensoredfc2
    • 2021-10-08
    161 min

    [RKI-619]The Story Behind How She Became An Obsessive Blowjob Fiend That Sucks Whenever She Can Ever Since She Was Taught How To Suck A Dick. Hotaru Nogi

  • nogi firefly censoredbig titsuniformRKIrookiemasaki naoRKI-619RKI619rki00619
    • 2021-10-23
    147 min

    [DBER-127]BeAST -Embarrassed Narcotics Investigator- Case 006: Rena Nagashima Beauties New Faith Shakes In Ravaging, Natsuki Takeuchi

  • natsuki takeuchi censoredbdsmsingle workDBERbaby entertainmentkikubonred babeDBER-127DBER127dber00127
    • 2021-11-18
    56 min

    230OREC-940 Miina (Miina Konno)

  • amateur censoredcreampieuniformorecorec-940orec940230orec-940
    • 2021-12-04
    136 min

    [AVSA-186]SUPER FISHEYE FETISHISM Super Thrilling And Exciting Closeup Action Huge Titties And A Massive Ass On A Double-The-Trouble Meaty And Erotic Body

  • kanae kawahara south wind sawa censoredbig titsAVSAavsbuddha davscollectorsAVSA-186AVSA186avsa00186
    • 2021-12-10
    244 min

    [HUNTB-155]I"m Timid And Can"t Even Say No To My Female Classmate That Wants To Come Over And Watch An AV... Then She Starts Feeling Lewd While Watching The AV And Can"t Stop Feeling Around My Crotch.

  • censoredcreampieschoolgirlHUNTBhunterborubo nakanohhh groupHUNTB-155HUNTB155huntb00155
    • 2021-12-14
    64 min

    200GANA-2602 Seriously Nampa, First Shot. 1728 F Breast Nurse Nampa Success! Experienced Number Of People 3 Digits! This Woman Who Catches A Man With An App, When She Shows Her Cheeks, She Is In Heat Immediately! Massive Squirting, Shaking Her Hips V

  • amateur censoredbig titssquirtingganagana-2602gana2602200gana-2602
    • 2022-01-01
    160 min

    [LULU-115]Wife Looking To Start Fresh On Her Second Marriage Has A Step-daughter With A Big Ass That Is Just Too Good, Now She"s My Favorite Step-daughter Who Sucks Me Down Her Throat And Swallows My Cum Loads Every Day. Yui Tenma

  • yui tenma censoredcreampieschoolgirlLULUlunaticsluminaxLULU-115LULU115lulu00115
    • 2022-01-01
    108 min

    [XVSR-631]As Soon As My Wife Left On A Business Trip I Spent All Night Fucking Her Adorable Younger Sister Ichika Matsumoto

  • ichika matsumoto censoredcreampiebeautiful girlXVSRmax ak c takedacalenXVSR-631XVSR631xvsr00631
    • 2022-01-08
    164 min

    [DGCEMD-107]Delivery Only! With Bonus Video Tearful Nonstop Orgasmic Fucking 15 Mika Kisaragi

  • mika kisaragi censoredmature womanDGCEMDcelebrity friendsDGCEMD-107DGCEMD107dgcemd00107
    • 2022-01-13
    53 min

    H4610 ki220113 Emi Hasegawa 21years old

  • amateur uncensoredh4610
    • 2022-01-15
    168 min

    [SORA-357]Exhibitionist Recruitment On Social Media Brings In A Girl That Seeks Attention Online All The Time, She"s A Pretty Gym Instructor With A Slim Waist And Busty Chest "I Want To Try Getting Super Lewd", She"s Shy Outside And H

  • sarina momonaga censoredbig titssingle workSORAyama to sorahimu lockSORA-357SORA357sora00357
    • 2022-01-18
    63 min

    10musume 011822_01 Let’s Have A Blast At The Resort Spa! Naomi Sakamoto

  • amateur uncensored10musume
    • 2022-02-01
    64 min

    Pacopacomama 020122_601 Housekeeping Agent Who Dug A Grave By Manzuri Act Yumi Nishizato

  • amateur uncensoredpacopacomama



    • Jav Cherry, watch JAV streaming online japanese xxx