housewife amateur censored javcensored jav




FC2NNPJMEYDSSISPPPDSDABKSBJGVHAUKSHODVNATRADNJUFEAWDWAAAMIDEGMEMHMNAVSAPREDVENU

2020-10-23
245 min

[MGT-124]Picking Up Amateur Girls On The Street Corner! vol. 93 Please Introduce Me To A Friend Who Is More Erotic Than You! 14

  • censoredcreampiesquirtingMGTprestigeno directormegatraMGT-124MGT124118mgt00124
    • 2020-10-25
    123 min

    [GENM-055]Picking Up Girls At A Midsummer's Sea 2 - Eimi Fukada

  • emi fukada censoredslutsingle workGENMgenekig 3GENM-055GENM055genm00055
    • 2020-10-30
    58 min

    [DHT-118]Real Amateur Wedding Variety Can I Do It With My Attractive Coworker？ Helping Out To The Point Of Annoyance! Now That We're Alone I Get To See Her In The Flesh Nana Nomura (22)

  • censoredamateurDHThot entertainmentyen ikkiDHT-118DHT11859dht00118
    • 2020-11-02
    61 min

    FC2PPV 1555507 Limited to 3 days [Individual shooting] Prefectural general course ③ Gal who goes to school by bicycle ・ Creampie while staying slowly

  • amateur uncensoredfc2
    • 2020-11-13
    113 min

    [CESD-944]Yui Hatano x Mihana They Both Get Horny When They're Tipsy... Two Lesbian Ladies Get Liquored Up Together For Hot, Steamy Sex!

  • yui hatano mihina azumihina mihina nagai censoredlesbianmature womanCESDceleb no tomoCESD-944CESD944cesd00944
    • 2020-11-19
    66 min

    [oretd-806]あすか

  • amateur censoredcreampiebig titsoretdoretd-806oretd806oretd-806
    • 2020-11-25
    66 min

    [orec-643]まいか先生

  • amateur censoredamateurbeautiful girlorecorec-643orec643orec-643
    • 2020-11-27
    60 min

    [WKD-036]Provocative Interview Room in USA Scarlet May

  • scarlet may censoredcreampiesingle workWKDwaap entertainmentk westwWKD-036WKD0362wkd00036
    • 2020-12-08
    118 min

    FC2PPV 1588973 [Personal shooting] Madoka-chan, a big-breasted hairdresser who loves belochu, subjective and objective set

  • amateur uncensoredfc2
    • 2020-12-13
    123 min

    [APNS-217]母娘強●懐妊 絶望実況配信 松本いちか 川上ゆう

  • ichika matsumoto yu kawakami morino morino censoredcreampieschoolgirlAPNSaurora project annexnasu yukihiroAPNS-217APNS217apns00217
    • 2020-12-13
    151 min

    [CHRV-121]I Can't Stand The Sight Of These Titties! My Little Stepsister Is An Abnormal Maso Bitch, And She's Got Big Tits That Are Worth More Than Just One Look! Hey Big Stepbrother, I'm A Pervert... J-Cup 112cm Titties Yuria

  • censoredcreampiebig titsCHRVcherry revolution daydream tribecherry s reboCHRV-121CHRV121chrv00121
    • 2020-12-26
    119 min

    [MIAA-369]A Married Woman With A Big Ass Is Walking Through The Apartment Building In The Afternoon, Showing Off Her Thong Panties, Transparently Visible Underneath Her Pants, And Luring Men To Temptation Yu Shinoda

  • shinoda yu censoredslutsingle workMIAAmoodyzryo inugamieveryone s porn starMIAA-369MIAA369miaa00369
    • 2021-01-09
    40 min

    275OCHA-079 Arisa

  • amateur censoredschoolgirlamateurochaocha-079ocha079275ocha-079
    • 2021-01-15
    329 min

    [YPTS-001]True Stories! Sugar Daddy Insertion: Amateur POV Leaked Pictures

  • censoredcreampiebig titsYPTSpetersYPTS-001YPTS001h-021ypts00001
    • 2021-01-29
    47 min

    [fan-098]ちなつ

  • amateur censoredamateurblowjobfanfan-098fan098fan-098
    • 2021-01-31
    14 min

    FC2PPV 1666678 (Limited time) Selfie neighborhood_a01_former underground idol_raw Gonzo

  • amateur uncensoredfc2
    • 2021-02-12
    301 min

    [SKMJ-148]Beautiful Y********ls In Uniform - First Creampies Encyclopedia - 15 People, 300 Minutes

  • censoreduniformmature womanSKMJred face girlSKMJ-148SKMJ148h-1324skmj00148
    • 2021-02-19
    153 min

    [MMKS-012]A Soapland Princess Who Gives You A Mean Service And Heals You With Her Massive Ass - Monami Takarada

  • takarada monami censoredbig titsMMKSmarrionkojiro miyamotoirisMMKS-012MMKS012mmks00012
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-03-16
    64 min

    Pacopacomama 031621_447 Parent and child appeared on porn video by being deceived to become a model! Mayu Otsuka

  • amateur uncensoredpacopacomama
    • 2021-03-21
    65 min

    420SWEET-008 Manamofu (18)

  • amateur censoredbig titsuniformsweetsweet-008sweet008420sweet-008
    • 2021-03-21
    119 min

    [DASD-834]Married Woman Seduced With Aphrodisiacs Pretends To Resist But Soon Becomes A Kinky Slut Hibiki Otsuki Rin Kira

  • otsuki sound kira rin censoredcreampiedramaDASDdasrokusaburo mishimaDASD-834DASD834dasd00834
    • 2021-03-24
    46 min

    495MOJ-010 Aoi

  • amateur censoredcreampieamateurmojmoj-010moj010495moj-010
    • 2021-03-27
    56 min

    230OREX-212 Ayase (H Cup)

  • amateur censoredcreampiebig titsorexorex-212orex212230orex-212
    • 2021-04-09
    116 min

    [DASD-845]Intense Creampie Inteview My Teacher's Huge Dick And Cum Won't Fit In Me... Kanon Amane

  • natural kanon censoredcreampieuniformDASDdaschinpo dazaiDASD-845DASD845dasd00845
    • 2021-04-14
    151 min

    [SSIS-041]Dominant Slut Ichika Hoshimiya Makes Tied Up Subs Bust Their Nuts For 20 Loads

  • ichika hoshimiya censoredslutsingle workSSISs1 no 1 stylesuisei akaiSSIS-041SSIS041ssis00041
    • 2021-04-14
    240 min

    [PPBD-209]I-Cups And Up - Huge Tits Only! These Enormous Boobs Will Titty Fuck You Until You Don't Have One Drop Of Cum Left - 45 Girls, 90-Nipple BEST Collection

  • julia tomoko kamisaka censoredbig titsPPBDoppaiPPBD-209PPBD209ppbd00209
    • 2021-04-18
    142 min

    [WNSK-003]Super Slutty Girls Big Titty Female S*****t / Metal Pipe Bondage / Rough Sex / Lots Of Squirting And Cumming

  • censoredbig titsschoolgirlWNSKwansuko daydream fantasy tribeWNSK-003WNSK003wnsk00003
    • 2021-04-26
    58 min

    10musume 042621_01 Amateur AV Interview: Comfortable to Hold this Petite Girl Rei Hashimoto

  • amateur uncensored10musume
    • 2021-05-01
    240 min

    [PRED-305]PREMIUM V.I.P Beautiful Girls From The 3 Biggest Production Companies Form A Harem 240 Minute Special Aika Yamagishi Nanami Misaki Mizuki Aiga

  • aika yamagishi nanami misaki censoredcreampieblowjobPREDpremiumusapyonelegancePRED-305PRED305pred00305
    • 2021-05-19
    104 min

    428SUKE-072 [Nasty black glow gal 3P] NATSUKI-chan ★ 3P continuous sex with brilliant rolling! !! Beautiful physical beauty of dancers! Declaration of permission for vaginal cum shot "drinking pills"! I can’t stop drinking alcohol while

  • natsuki censoredcreampieamateursukesuke-072suke072428suke-072
    • 2021-05-21
    118 min

    [JUL-588]My Classmates Are Always Picking On Me And Bully Me By Fucking My Mom! Maki Tomoda

  • maki tomoda censoredmature womanmomJULmadonnajyoji kawaiJUL-588JUL588jul00588
    • 2021-06-02
    127 min

    [GVH-242]露出・輪●・ぶっかけ願望に憑りつかれた女 渚みつき

  • scooping censoredslutsingle workGVHglory questusubashisuiGVH-242GVH24213gvh00242
    • 2021-06-11
    40 min

    FC2PPV 1862550 Limited number [Uncensored] Active professional student with a lovely smile like a girl! Raw vaginal cum shot at 19 years old! !!

  • amateur uncensoredfc2
    • 2021-06-18
    90 min

    FC2PPV 1875083 [No individual shooting, huge breasts Hcup, married woman NTR, outflow, decachin forced NTR] Pretty dangerous video! An Affair Married Woman OL Who Dislikes After Being In Love With A Secret Meeting For The First Time In A Long Time Is

  • amateur uncensoredfc2
    • 2021-07-30
    93 min

    300NTK-613 [Pecan! !! 3 Beautiful Girls! !! All Innocent Bitch! !! Gangbang "6P" Special! !! ] Exactly Sake Pond Meat Forest! !! Beautiful Girl X 3 People! !! All The Miraculous Three Sexes Called De Nasty Dovich Gather Under The Clear Sky An

  • amateur censoredcreampiesquirtingntkntk-613ntk613300ntk-613
    • 2021-08-06
    240 min

    [HODV-21600]I Can"t Keep My Eyes Off Of My Private Tutor"s Tits I Can"t Study Like This!!!

  • censoredHODVh m pHODV-21600HODV216005642hodv21600
    • 2021-08-07
    59 min

    383REIW-089 Rion

  • amateur censoredbig titsamateurreiwreiw-089reiw089383reiw-089
    • 2021-09-03
    120 min

    [CAWD-283]On The Way Home After The Sauna, It"s Time For Shared-Room NTR Her Boyfriend Was Freeloading Off Of Her Wages, So When Her Boss At Her Part-Time Job Was Nice Enough Enough To Listen To Her Complaints, He Creampie Fucked Her Until She Dr

  • momose asuka censoredcreampiesingle workCAWDkawaiiarashiyama michiruCAWD-283CAWD283cawd00283
    • 2021-09-03
    32 min

    FC2PPV 2140399 [No 〇 Positive] 19-Year-Old Natural Vaginal Cum Shot Support With D Cup Professional Students 〇

  • amateur uncensoredfc2
    • 2021-09-18
    47 min

    500DPL-0033 AV Debut! Furthermore, Sudden Vaginal Cum Shot! Yoshino Yuki 27 Years Old

  • amateur censoredcreampieamateurdpldpl-0033dpl0033500dpl-0033
    • 2021-10-03
    68 min

    FC2PPV 2287557 [Ranking 1st] Koharu 18 Years Old, Raw, Facial Cumshots. Black-Haired Pure Baby-Faced Kodomo Similar To Non (Rena Nonen) Is The First Compensated Dating Of The Decision! I Can’T Stop Looking At The Camera From The Idol Face! [Abso

  • amateur uncensoredfc2
    • 2021-10-07
    84 min

    [inst-172]ナミ(22)

  • amateur censoredcreampiebig titsinstinst-172inst172inst-172
    • 2021-10-08
    38 min

    FC2PPV 2310228 First And Last Appearance! !! Limited Number! [Uncensored] Beautiful Proportions That Won The Former Beauty Pageant Grand Prix. Creampie On The Sensitive Body Of A Beautiful Woman Who Also Handles Fashion Models! !! This Is Her Last Wo

  • amateur uncensoredfc2
    • 2021-10-09
    151 min

    [SCOP-741]The Life Insurance Lady Who Came To Do Business With Us Was Surprisingly Bra-less And Panty-less! I Was Going To Turn Her Down 120 Of The Time, But My Virgin Dick Got So Stiff I Couldn"t Hold Back And I Had To Have Sex With Her On The S

  • censoredcreampiebig titsSCOPk m producek tarouscoop kmpSCOP-741SCOP741scop00741
    • 2021-10-15
    110 min

    FC2PPV 2345887 [Price Until Tomorrow] Dero Video When A Beautiful AV Actress With Too Strong Libido Was Always Vaginal Cum Shot In Saffle / Part 1 [Unreleased / Uncensored]

  • amateur uncensoredfc2
    • 2021-10-28
    63 min

    FC2PPV 2382636 A Small Animal Girl Who Came As A Nude Model. When I Was Looking At The Delicate And Small Body, I Wanted To Get Rid Of It And Negotiated Gonzo! !!

  • amateur uncensoredfc2
    • 2021-11-12
    72 min

    328HMDN-426 [Beautiful Nurse Chief 47 Years Old] Unfaithful Outflow In The Hospital With A Man Under 20 Years Old In The Hospital. Sex That Is Fainting While Being Fucked By A Young Cock That Squirts [Outflow] (Hitomi Honjo)

  • amateur censoredcreampiemarried womanhmdnhmdn-426hmdn426328hmdn-426
    • 2021-12-02
    132 min

    [JRZE-088]First Time Filming My Affair. Kanako Yamashita

  • yamashita kanako censoredcreampiemature womanJRZEcenter villagefukagawa jiroushoku ureJRZE-088JRZE088h-086jrze00088
    • 2021-12-09
    67 min

    FC2PPV 2503229 * Limited Special Price [Cuckold] Former Jinnu Candidate, An Affair Date With A Beautiful Dancer Youtuber From Osaka Gei University! Soft Body Gonzo Video Leaked [cen]

  • amateur uncensoredfc2
    • 2021-12-09
    115 min

    [AARM-042]Can"t Take Off My Cute Clothes. Stick Dick In With Panties Pulled Down Over Pretty Clothes. Healing Forest Girls Version.

  • chiharu miyazawa hinako mori censoredbeautiful girlAARMaroma kikakuhamu oujiaromaAARM-042AARM042aarm00042
    • 2021-12-10
    477 min

    [OFJE-340]Mai Shiomi"s First Best S1 Debut 1st Anniversary Latest 10 Titles 8 Hours Special

  • mai shiomi censoredbeautiful girlsingle workOFJEs1 no 1 styleOFJE-340OFJE340ofje00340
    • 2021-12-10
    107 min

    [VENX-098]"Do My Panties Turn You On？" Aunt Who Squeezed Last Drop of Nephew-In-Law"s Sperm WIth Half Removed Panties. Akari Neo

  • akari neo censoredcreampiemature womanVENXvenusmajime kitanofakecest winntersVENX-098VENX098venx00098
    • 2021-12-25
    125 min

    [ONSG-046]Big Tits Deli Hino Fuwari

  • hino fluffy censoredcreampiebig titsONSGgain corporationONSG-046ONSG046onsg00046
    • 2022-01-14
    39 min

    359TYVM-225 I Hate Mannery Sex With My Husband Anymore! Creampie Sexual Intercourse With A Slender Wife Who Seeks Intense Play! (Natsume Hikari)

  • amateur censoredcreampiemarried womantyvmtyvm-225tyvm225359tyvm-225
    • 2022-01-20
    125 min

    [FANH-059]Just Before My Wedding, My Friend"s Girlfriend Tsukimi-chan A Commemorative Gonzo Cheat Session Right Before The Wedding Self-Shot Serious Tongue-Kissing Memories Raw Fucking Babymaking Creampie

  • censoredcreampieamateurFANHhamedori.network secondeditionFANH-059FANH059h-1472fanh00059



    • Jav Cherry, watch JAV streaming online japanese xxx