hitomi




FC2AUKGPREDADNSDABDTTSSISSQTEDASDAVSAABWSHKDMIDEMILKFSDSSMIDVMEYDATIDHNDVENXLULU

2020-11-20
93 min

[AIMS-020]Kokoa Sato/Pure Girl

  • sato cocoa censoredbeautiful girlAIMSmedia brandjelly beAIMS-020AIMS020301aims00020
    • 2020-11-29
    43 min

    FC2PPV 1587765 * Uncensored * There is a gorgeous review privilege ☆ First shot ☆ Main story appearance ♡ 24 years old, contrary to the cute face, 20 times in a row! ？？ Gonzo SEX during life ♡

  • amateur uncensoredfc2
    • 2020-12-07
    53 min

    [gerk-331]しおりお姉ちゃん

  • amateur censoredcreampieamateurgerkgerk-331gerk331gerk-331
    • 2020-12-08
    47 min

    H0930 ki201208 Kayoko Sahara 30years old

  • amateur uncensoredh0930
    • 2020-12-14
    45 min

    FC2PPV 1606528 ☆ Limited discount! ☆ Naive amateur girl Yukina. Being vulnerable to pushing, the innocent body is polluted as much as you like … [Multiple benefits available] [No individual shooting]

  • amateur uncensoredfc2
    • 2021-01-06
    43 min

    [sika-005]らむ(18)

  • amateur censoreduniformschoolgirlsikasika-005sika005sika-005
    • 2021-01-10
    121 min

    [VEC-459]Mom's Best Friend Yumi Sakurai

  • yumi sakurai censoredcreampiemature womanVECvenussarumegami venusVEC-459VEC459vec00459
    • 2021-01-23
    118 min

    [HND-940]Because Her Husband Was Shooting Blanks, This Married Woman Went To A Rundown Shack And Had Deep And Rich Babymaking Sex With A Single Man Who Had Been Saving Up His Sperm For 30 Days And Enjoyed Herself In The Process Ai Sayama

  • sayama love censoredcreampiebig titsHNDhon nakahiroaHND-940HND940hnd00940
    • 2021-01-25
    100 min

    [HIGR-013]At A Love Hotel With Tsubasa Akimoto / Tsubasa Akimoto

  • amateur censoredbig titsbeautiful girlHIGRintec incHIGR-013HIGR013
    • 2021-02-01
    193 min

    [HR-004]Nipple Store: Super Sensitive A-cups No Milk, But That Makes Me More Sensitive - Rion Izumi

  • rion izumi censoredcreampieamateurHRplumhimu lockshirouto only plumHR-004HR004h-113hr00004
    • 2021-02-13
    180 min

    [AUKS-122]Lesbian Mania - Squirting, Tribbing Lesbians - Azusa Misaki Momo Hazuki

  • misaki azusa hazuki peach censoredsquirtinglesbianAUKSu kroshilvia takiguchiAUKS-122AUKS122auks00122
    • 2021-02-22
    125 min

    [LDNS-015]Nasty Big Tits 12 - Kanan Harukawa

  • what is harukawa censoredcreampiebig titsLDNStoyohikozarakiseiunkaiLDNS-015LDNS015ldns00015
    • 2021-02-26
    48 min

    [MASE-015]Horny Older Women 33 Year Old Hotaru Big Mature H Cup Titties And Curvy Body Arching Backs And Raw Fucking! Hotaru Mori

  • hotaru mori censoredcreampiebig titsMASEcrystal picturemadam maniac plusMASE-015MASE01549mase00015
    • 2021-03-06
    150 min

    [PRED-292]Slender Straddling - This Cute Sisterly Girl And Her Bouncy Ass Wants To Get Sluttier - Mami Sakurai

  • mami sakurai censoredslutsingle workPREDpremiumtrendy yamaguchielegancePRED-292PRED292pred00292
    • 2021-03-19
    58 min

    [jpak-004]あや

  • amateur censoreduniformschoolgirljpakjpak-004jpak004jpak-004
    • 2021-03-25
    210 min

    [PIYO-109](With Streaming-Only Bonus Footage) "Make Me Your Bride, Papa" A Stepdad's Strange Relationship With His Barely Legal Stepdaughter Leads To Creampie Sex

  • censoredcreampiePIYOhyokopiero daamaenboPIYO-109PIYO1091piyo00109
    • 2021-03-31
    70 min

    259LUXU-1398 Luxury TV 1385 A frustrated beauty blogger in a long-distance relationship makes an AV appearance. If you caress the whole body gently, it heats fair skin and reacts sensitively, overflows honey and accepts the penis and is disturbed!

  • amateur censoredbig titsamateurluxuluxu-1398luxu1398259luxu-1398
    • 2021-04-15
    117 min

    [OMHD-006]Shocking Mental Experiment - "How To Reproduce Pavlov's Dog In Real Life" - S********l Administered Electric Shocks To Transform Her Into A Total Cock Slut. Hinako Mori

  • hinako mori censoredschoolgirlsingle workOMHDdogmamigiwa otaOMHD-006OMHD006omhd00006
    • 2021-04-20
    136 min

    [STARS-353]A Coed Bathing Employee Trip NTR My Colleagues Love To Hit The Bathhouse, So We Went To A Private Bath And That's Where I Saw My Wife Getting Her Brains Fucked Out ... Suzu Honjo

  • suzu honjo censoredcreampiesingle workSTARSsod createamazing meatsod starSTARS-353STARS3531stars00353
    • 2021-05-01
    187 min

    [NKKD-205]Married Woman Gets Nailed In A Pubic Bathroom While On A Drive With Her Family! 6 Toilet Cheating

  • censoredmature womanNKKDjet eizomanji groupNKKD-205NKKD205nkkd00205
    • 2021-05-01
    120 min

    [NACR-415]Are They Going To Taste-Test Each Other's Boyfriends!？ These Shaved Pussy Sisters Are Getting Wild For A Foursome Fuck Fest!! Chiharu Miyazawa Yuha Kiriyama

  • chiharu miyazawa kiriyama yuu censoredNACRplanet plusbito sakurananakuruNACR-415NACR415h-237nacr00415
    • 2021-05-01
    140 min

    [NKKD-207]When My Husband's Colleague Made Moves On Me ... My Colleague Is Single, Loves Sex Clubs, And Is Unequaled In His Love Of Big Tits, And Now He's Set His Sights On My Wife (And Her Colossal Tits) ... Hana Haruna

  • haruna hana censoredmature womansingle workNKKDjet eizomanji groupNKKD-207NKKD207nkkd00207
    • 2021-05-01
    115 min

    [NACR-420]An Art College S*****t With A Slender Body And Beautiful Tits When She Asked Her Stepfather To Pose As A Nude Model He Got Super Excited And Creampie Fucked Her Karen Otoha

  • karen otoha censoredcreampiebig titsNACRplanet plusdirector onanakuruNACR-420NACR420h-237nacr00420
    • 2021-05-02
    130 min

    [FLAV-267]Give Your Cock A Tune-Up: Erection Assistant Girls - Voluptuous Cock Cheerleader With Colossal Tits

  • censoredbukkakeFLAVdigital arkdigital ark digital arkFLAV-267FLAV267flav00267
    • 2021-05-05
    84 min

    259LUXU-1426 Luxury TV 1400 An Innocent President’s Daughter And President’s Secretary With One Experienced Person Appears In AV To Know The Outside World! The outstanding glamorous body that is disproportionate to the cute looks that seem

  • amateur censoredbig titsamateurluxuluxu-1426luxu1426259luxu-1426
    • 2021-05-17
    55 min

    FC2PPV 1821533 * Unauthorized sale. 20-year-old fair-skinned beautiful breasts like a French half. Although it is salt compatible, after inserting the cock, the soaked pussy reacts intensely and a large amount of vaginal cum shot is made.

  • amateur uncensoredfc2
    • 2021-06-03
    13 min

    FC2PPV 1851088 Limited to 9 [Individual shooting] Prefectural general course (2) One month from the first experience … A girl who tastes the sperm accumulated by her uncle because she wants pocket money.

  • amateur uncensoredfc2
    • 2021-06-11
    148 min

    [MEYD-684]Time Stopping - The Pleasure From An Aphrodisiac Explodes In A Twitching Orgasm! Mihina

  • mihina azumihina mihina nagai censoredcreampiesingle workMEYDtameike gorokitorune kawaguchiMEYD-684MEYD684meyd00684
    • 2021-06-18
    61 min

    230OREC-790 Hisui

  • amateur censoredcreampiebig titsorecorec-790orec790230orec-790
    • 2021-06-22
    137 min

    [KMHRS-044]Her Face and Body are Perfect？ An Unexpectedly Serious and Somewhat Masochistic and Perfectly Irresistable Gal's AV Debut Rima Arai

  • lima arai censoredbig titsamateurKMHRSsod creater40i fell in love with youKMHRS-044KMHRS0441kmhrs00044
    • 2021-07-03
    132 min

    [DNJR-054]My Little Stepsister Owns Me With Her Handjob Skills Mio Ichijo

  • ichijo mio censoredsluthandjobDNJRdog daydreamersmaboroshikoDNJR-054DNJR054dnjr00054
    • 2021-08-07
    74 min

    FC2PPV 1971539 [Personal Shooting] 67th Shooting Kanon 18 Years Old Is A Sober Child With Bristles! Dirty Words Barrage Sure Satisfaction! Life’S First Tokuno Fishy Odor Semen Cum Shot In The Horny Vagina Uterus Hidden Behind The Horny Hair [Tor

  • amateur uncensoredfc2
    • 2021-08-13
    75 min

    374IMGN-019 Noai

  • amateur censoredcreampiebig titsimgnimgn-019imgn019374imgn-019
    • 2021-08-24
    115 min

    460SPCY-021 [20 Years Old Kanagawa Prefecture] Yui

  • amateur censoredcreampiebig titsspcyspcy-021spcy021460spcy-021
    • 2021-08-28
    44 min

    [PSST-031]Two Holes At Once! Blond Married Woman Gets Filled Up For Double Dick Penetration - Pussy And Anal! Winny

  • censoredmarried womanamateurPSSTpatzkin amateurbooker tPSST-031PSST031h-1450psst00031
    • 2021-08-29
    49 min

    292MY-459 Sho Miyoshi 1

  • amateur censoredmarried womanamateurmymy-459my459292my-459
    • 2021-09-20
    97 min

    [VNDS-3375]Pocket Pussy Saleswoman 23

  • sakisui ran yamabuki censoredblowjobmature womanVNDSstar paradisenext11VNDS-3375VNDS3375h-254vnds03375
    • 2021-09-24
    158 min

    [HMN-042]The Beautiful Skin Contest Grand Prix This Barely Legal Babe Has The Complexion Of A 3-Year Old, And She"s Got A Nice And Tight Pussy To Match! A Natural Airhead Supple-Skinned Baby-Faced Barely Legal Babe Her First Raw Creampie Mirai Ya

  • yagami future censoredcreampiebig titsHMNhonnakamamezawa mametarouHMN-042HMN042hmn00042
    • 2021-09-25
    120 min

    [SRMC-036]Influencer RED vs. Ayaka Mochizuki - Cute Influenced Bitch Ayaka Mochizuki

  • ayaka mochizuki censoredcreampiebig titsSRMCsaimin rashrassha miyoshiSRMC-036SRMC036srmc00036
    • 2021-10-06
    124 min

    300MIUM-747 [Raw Zar Cum] If "I Don’t Drink Sperm", Let Me Drink It! Malicious Planning. The Sperm Blame Of Angry Waves When They Were Alone During The Preview. (Shiori Hirai)

  • amateur censoredamateurmiummium-747mium747300mium-747
    • 2021-10-08
    211 min

    [HUNTB-117]Cleaning -Shota Kitano-

  • censoredblowjobsisterHUNTBhunterkonnyaku kannohhh groupHUNTB-117HUNTB117huntb00117
    • 2021-10-12
    480 min

    [KTRA-338]Sex with My Short, Lolita-Type Younger Stepsister, 10 Girls, 8 Hours, A Set of 2 DVDs

  • toua kotone risa kudo censoredcreampieKTRAk tribeKTRA-338KTRA338h-094ktra00338
    • 2021-10-22
    139 min

    [JUL-749]Exclusive: After 11 Years, Maki Tomoda Is In S&M Again! See Her Get All Tied Up With The Village Mayor, And Lose Her Mind In 72 Hours Of Roped Pleasure.

  • maki tomoda censoredbig titsmature womanJULmadonnakubo nawoyukiJUL-749JUL749jul00749
    • 2021-10-28
    21 min

    [HEYZO-2646]Rei Kitajima Erotic Massage for Rei

  • rei kitajima uncensoredhandjobcumshotheyzo
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-10-29
    51 min

    [HEYZO-2643]rin POV Fuck With A Pervert Girl Loving To Expose In SNS Vol.01

  • rin uncensoredheyzo
    • 2021-10-30
    140 min

    [PKPD-168]Dental Assistant Sex Friend Iroha-chan With A Certain Personality Can"t Say No to Cuckoldry! Iroha Minami

  • minami iroha censoredcreampieblowjobPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-168PKPD168pkpd00168
    • 2021-11-17
    106 min

    420HOI-171 Ayume (Hanamiya Amu)

  • amateur censoredbig titsamateurhoihoi-171hoi171420hoi-171
    • 2021-11-20
    119 min

    [GENM-094]8 Scenes Minami Iroha Pulling Out Masturbator!

  • minami iroha censoredblowjobhandjobGENMgenekigoldfish dGENM-094GENM094genm00094
    • 2021-11-27
    61 min

    10musume 112721_01 Dynamite Body Is Disturbed By Phallic Insertion Miho Oyama

  • amateur uncensored10musume
    • 2021-12-01
    58 min

    ORE-805 Monami-San 3 (Monami Takarada)

  • amateur censoredcreampiebig titsoreore-805ore805ore-805
    • 2021-12-03
    150 min

    [WAAA-126]This Beautiful Girl Was Held In Confinement In This Decrepit Home By A Horny, Dirty Old Man And Impregnated With Semen Bukkake And Soiled To Her Soul While She Came With Pleasure ... Meisa Kawakita

  • kawakita meisa censoredcreampiebig titsWAAAones factorywanzWAAA-126WAAA126waaa00126
    • 2021-12-10
    230 min

    [HUNTB-159]Getting Lewd With A Female Friend As Soon Her Boyfriend Dumps Her! Crazy Sex Till Morning To Keep The Loneliness Away! Friends That Are A Couple At My College Come Over To Have A 3-person Party! Bickering Turns Into A Fight...

  • censoredblowjobHUNTBhunterkawajirihhh groupHUNTB-159HUNTB159huntb00159
    • 2021-12-10
    216 min

    [HUNTB-158]"Is Step-sis Masturbating？" Step-sis Is On All Fours Masturbating With A Pen Between Her Legs, Training Her Lower Body And Ready For A Surprise...

  • censoredcreampiesisterHUNTBhunterkoichi davidsonhhh groupHUNTB-158HUNTB158huntb00158
    • 2021-12-10
    66 min

    [mla-050]喜保(26)

  • amateur censoredcreampiebig titsmlamla-050mla050mla-050
    • 2021-12-15
    95 min

    435MFC-167 [Beautiful Nursery Teacher, Shameful Sex By The Window From Midday! !! !! !! ] You May Be Able To See It From The Outside & The Excitement Is Max With The Camera For Gonzo! !! Over There Is Soaked ♪ Namanaka Ecchi For Uncontrollable Sex

  • amateur censoredcreampieamateurmfcmfc-167mfc167435mfc-167



    • Jav Cherry, watch JAV streaming online japanese xxx