high vision jav school stuff schoolgirl censored




FC2MIAAHDKAAVSARBDAWDSDABBBANGVHSHKDNACXONEZWANZCAWDHNDPPPDFSDSSCHRVMARAMIDVDTT

2021-01-08
162 min

[HEZ-236]Married Women Share Their Adulterous Experiences! Let's Forget About Our Sins Together! A Threesome With Two Married Women Will Make You Feel Like A King! Luxury Pick Up Sex 3

  • censoredbig titssquirtingHEZhot entertainmentnetsuyujinhitotzuma hot entertainmentHEZ-236HEZ23659hez00236
    • 2021-01-12
    50 min

    H4610 ki210112 Eri Maeda 19years old

  • amateur uncensoredh4610
    • 2021-01-21
    153 min

    [NHDTB-487]A Cafe Girl Chain Reaction Fuck Fest A Chain Reaction Fuck Fest Project That Takes Advantage Of Obedient Cafe Girls Who Cum While They're On The Job

  • censoredbig titsuniformNHDTBnatural highrafting maeshiroNHDTB-487NHDTB4871nhdtb00487
    • 2021-01-23
    120 min

    [JBJB-019]ドM願望あるバイリンガル美女は初めてのおじさんとのSEXでたっぷり体液交換しちゃいました！ 望月りさ

  • risa mochizuki censoredsingle workJBJBsharkjabujabu machiJBJB-019JBJB019h-687jbjb00019
    • 2021-01-25
    57 min

    [tkwa-154]はな 2

  • amateur censoredcreampiebig titstkwatkwa-154tkwa154tkwa-154
    • 2021-01-26
    117 min

    [NUBI-047]I Went To A Masturbation Club And Wasn't Satisfied With Just A Handjob, And This Sexy Girl At First Demurred, But I Could Tell She Was Enjoying It, So I Fucked Her.

  • censoredhandjobNUBIkalimantannubiaNUBI-047NUBI047h-1112nubi00047
    • 2021-02-09
    141 min

    [MSFH-051]都合の良い愛人と。 Case02:受付嬢あみ 希代あみ

  • kiyo ami censoredsingle workMSFHsod createsuisei akaims sodMSFH-051MSFH0511msfh00051
    • 2021-02-12
    49 min

    FC2PPV 1683388 [Personal shooting] The beauty receptionist of a department store has drastically reduced her work, and she is desperate to earn living expenses! [Creampie]

  • amateur uncensoredfc2
    • 2021-02-17
    54 min

    [sika-046]ゆりあ 2(18)

  • amateur censoredschoolgirlamateursikasika-046sika046sika-046
    • 2021-02-18
    70 min

    [AKDL-087](Tokyo Girls) She's Performing In This Video While On Her Way Home From Work! A Horny Office Lady Who Loves To Suck Dick Late At Night She Suddenly Begged For A Threesome # A Maso Bitch # She Loves To Suck Dick # Instant Spasmic Orgasms

  • censoredamateurAKDLaquinoriaquinoriaknrAKDL-087AKDL0871akdl00087
    • 2021-02-19
    12 min

    FC2PPV 1693328 Rio Yukopi Tech I had him pull out with a camera while I was playing

  • amateur uncensoredfc2
    • 2021-02-20
    65 min

    324SRTD-0210 If you teach big breasts with a cute smile a different dimension of pleasure, you will be in a situation where “Dangerous! Impossible!”

  • amateur censoredbig titsamateursrtdsrtd-0210srtd0210324srtd-0210
    • 2021-02-20
    63 min

    200GANA-2440 Seriously Nampa, first shot. 1600 Discovered a beautiful office lady in Ikebukuro! I had them take off their skin to prevent premature ejaculation! ？？ Anyone will explode in the appearance of Bon, Kyu, Bon’s attractive body shape co

  • amateur censoredbig titsamateurganagana-2440gana2440200gana-2440
    • 2021-03-11
    120 min

    [FSDSS-189]Shameful Sexy Model Rides Dick Cowboy Style And Squirts Juices Everywhere! Sara Kamiki

  • sara kamiki censoredbig titssingle workFSDSSfalenokaorufaleno starFSDSS-189FSDSS1891fsdss00189
    • 2021-03-19
    160 min

    [DOCP-283]My Friend And His Girlfriend Are Always Hanging Out At My Place Because They Say It's So Close To School. And When I Saw Her There Resting In My Room, Without A Care In The World, I Could No Longer Contain My Excitement ...

  • horikita wa saya matsui censoredcreampieslutDOCPprestigedoc premiumDOCP-283DOCP283118docp00283
    • 2021-04-05
    120 min

    [TUE-111]Rough Fucked Inside A Toilet: A Submitted Video

  • censoredcreampieuniformTUEglay zteitora eizoTUE-111TUE11112tue00111
    • 2021-04-10
    61 min

    Caribbeancom 041021-001 A hot wife who can’t resist ex-boyfriend Emi Sakurai

  • emi sakurai uncensoredcreampiecaribbeancom
    • 2021-04-23
    46 min

    FC2PPV 1767772 [Personal shooting] Tomohame! I took a gonzo like a friend ☆ Moe 24 years old ☆

  • amateur uncensoredfc2
    • 2021-05-01
    120 min

    [NACR-417]A Video Record Of Sex With A Son's Wife That Day, My Kind And Gentle Father-In-Law Became A Rough Sex-Loving Demon Chitose Shinohara

  • chitose shinohara censoredbig titsmature womanNACRplanet plusbito sakurananakuruNACR-417NACR417h-237nacr00417
    • 2021-05-06
    92 min

    [KAAD-053]My Beautiful Mother-in-Law Akiko Izumi

  • ryoko izumi censoredcreampiemarried womanKAADcenter villagejiro fukagawahanazono center villageKAAD-053KAAD053h-086kaad00053
    • 2021-06-01
    244 min

    [NACX-081]Slender Mature Woman Creampie, 18 People BEST

  • shiho ayako inoue censoredcreampiemature womanNACXplanet plusnanakuruNACX-081NACX081h-237nacx00081
    • 2021-06-12
    146 min

    [DVAJ-517]Girl Who Lives Across The Way Seduced Me By Touching Herself While I Watched Nanami Kawakami

  • kawakami nanami censoredcreampieslutDVAJalice japanbieber gonzoDVAJ-517DVAJ517dvaj00517
    • 2021-06-13
    102 min

    390JNT-022 [G Breast Whip Whip Married Woman] I ● Put an erotic selfie on the star, pick up a G cup married woman on SNS! !! The real married woman of transcendental Eros that overwhelms the actor is too fierce! !! Squeeze sperm while cramping BODY a

  • amateur censoredcreampiebig titsjntjnt-022jnt022390jnt-022
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-20
    115 min

    [AGMX-080]Nipple Play Facesitting Handjob - Three-Point Climax

  • usui ren marina saito censoredsluthandjobAGMXsex agent daydreamersdaibutsu yoshidasex agentAGMX-080AGMX080agmx00080
    • 2021-06-22
    41 min

    FC2PPV 1882520 [No] [Limited to 100 pieces 2980 → OFF to 1480pt!] A certain fashion magazine reading mode finalist! Advent ♥ ️ I love naughty things! ♥ ️ * Review benefits / Sexy underwear masturbation

  • amateur uncensoredfc2
    • 2021-06-24
    200 min

    [SVDVD-863]Hold Out And Win A Prize! If You Fail It's Instant Penetration By Huge Cock! Teen College Girl Squatting Face Sitting Cunnilingus Challenge! She Cum And Squirts Over And Over Again As The Hood On Her Sensitive Clit Is Peeled Back And L

  • censoredcreampiesquirtingSVDVDsadistic villagenew kazi kazamaamateur participation varietySVDVD-863SVDVD8631svdvd00863
    • 2021-06-24
    175 min

    [NHDTB-546]This Slut Knows How To Make Guys Cum - Men Can't Resist Her Aphrodisiac Kisses And Skillful Handjob Technique

  • censoredamateurbeautiful girlNHDTBnatural highneapolitanNHDTB-546NHDTB5461nhdtb00546
    • 2021-07-10
    129 min

    [BAEM-011]Naughty Young Lady's Impure Love Sakura Tsuji

  • sakura tsuji censoredcreampiebeautiful girlBAEMbaltandaibutsu yoshidaemeraldBAEM-011BAEM011baem00011
    • 2021-07-13
    61 min

    521MGFX-007 Excavation ☆ Breast Milk Amateur 1

  • amateur censoredcreampieschoolgirlmgfxmgfx-007mgfx007521mgfx-007
    • 2021-07-17
    120 min

    [HMN-015]She Loves To Get Totally Naked! A G-Cup Big Tits Openly Erotic Beautiful Girl Is Being Filmed In Creampie Raw Footage For The First Time A Currently Active, 20-Year Old College Girl Freshman! Haruka Kishii

  • haruka kishii censoredcreampiebig titsHMNhon nakamametaro mamezawaHMN-015HMN015hmn00015
    • 2021-07-22
    120 min

    [FSDSS-250]Hey, Shiina! A Revenge Orgasmic Documentary By Actors, Directors, And Managers Who Have All Been Treated Like Garbage By Sora Shiina!!

  • shiina sky censoredblowjobbeautiful girlFSDSSfalenomanyufaleno starFSDSS-250FSDSS2501fsdss00250
    • 2021-07-30
    59 min

    [WKD-044]Provocative Interview Room. Ruka Inaba.

  • inaba censoredbig titsblowjobWKDwaap entertainmentk westwWKD-044WKD0442wkd00044
    • 2021-07-31
    136 min

    [FLAV-277]The Sexy Amateur Women In Masks Have Plump, Colossal Tits And Big Asses, And They Are Sluts Who Gratify Our Sexual Desires

  • censoredamateurFLAVdigital arkdigital ark dejitarua kuFLAV-277FLAV277flav00277
    • 2021-08-06
    121 min

    [UMD-789]Penetrated!! Famous Lymphatic Massage Shop 8: "How About the Backdoor Option？"

  • scooping himari kinoshita himari hanazawa censoredhandjobUMDleodoragon nishikawaUMD-789UMD789125umd00789
    • 2021-08-17
    35 min

    361SEKAO-159 Siwon From South Korea

  • amateur censoredbig titsamateursekaosekao-159sekao159361sekao-159
    • 2021-08-20
    96 min

    [VNDS-3372]The Stepmom Who Pays A Night Visit To Her Stepson"s Apartment

  • censoredcreampiehandjobVNDSstar paradisenext11VNDS-3372VNDS3372h-254vnds03372
    • 2021-09-01
    122 min

    435MFC-137 [Erotic Brilliant Orgy Friends] Mechakawa Twins Outfit Duo Boyfriend Exchange Swapping Sex! My Boyfriend’S Friend Also Participated In The War And 5 People Got Mixed Up And 7 Ejaculations Of Raw Squirrel And Turmoil! [Shiroto Gonzo ＃

  • amateur censoredcreampiesquirtingmfcmfc-137mfc137435mfc-137
    • 2021-09-03
    179 min

    [MIFD-176]Newcomer, 19 And Half, Y********l. She Wants To Be An Adult. JAV DEBUT Kazuna Yuuki

  • kazuna yuki censoredbeautiful girlsingle workMIFDmoodyzusapyonmoodyz freshMIFD-176MIFD176mifd00176
    • 2021-09-04
    245 min

    [SORA-331]The Erotic Terrorist I Pray That You Will Awaken To The Pleasures Of Outside Nudes It"ll Be Trouble If You Ejaculate Here, But This Dirty JK Slut Will Tempt You With Dirty Talk, And Drain Your Balls Dry Of Your Semen Ai Kawana

  • ai kawana censoredschoolgirlblowjobSORAyama to soradenchuuSORA-331SORA331sora00331
    • 2021-09-14
    65 min

    Pacopacomama 091421_531 Married Woman And Brother-In-Law Suffering From Bad Husband Rina Shirakawa

  • amateur uncensoredpacopacomama
    • 2021-09-28
    94 min

    FC2PPV 2260544 [No Amateur Individual Shooting] A Beautiful Girl Who Is Super Sensitive To The Whole Body And Has Sexual Desire Without A Boyfriend For Half A Year And Refraining From Going Out! The Feeling Of Love That The Pussy Aches And The Hips M

  • amateur uncensoredfc2
    • 2021-10-02
    57 min

    188HINT-0480 Kasumi

  • amateur censoredcreampiebig titshinthint-0480hint0480188hint-0480
    • 2021-10-08
    149 min

    [JUL-731]I Was Adrift, At The Whims Of Her Sweet Whisperings, Trapped In A Nest Of Sexual Pleasures With A Married Woman, Until I Had To Repeat Another Year Of College ... Kana Mito

  • kana mito censoredmature womansingle workJULmadonnakimura hiroyukiJUL-731JUL731jul00731
    • 2021-10-16
    240 min

    [SYKH-035]Hard Piston Action Climax Threesome Creampie Wife Mouth And Pussy Are Shared By Everyone And Become A Loose Meat Urinal

  • censoredcreampiemarried womanSYKHleisure mrs emanielSYKH-035SYKH035sykh00035
    • 2021-11-04
    57 min

    230OREC-924 Chiharu (Chiharu Sakurai)

  • amateur censoredcreampieamateurorecorec-924orec924230orec-924
    • 2021-11-05
    118 min

    [JUL-771]Chance Reunion With Sexual Harassment Teacher From S*****t Days as Prostitute. From That Day Made To Become a Subservient Pet... Nana Hayami

  • don t be quick censoredmature womansingle workJULmadonnashouten shirouJUL-771JUL771jul00771
    • 2021-11-26
    49 min

    FC2PPV 2433661 [Personal Shooting] Mizuki Face Up 28 Years Old A Healthy And Preeminent Style Married Woman Licks The Whole Body And Cums A Lot Of Super Big Cock! !!

  • amateur uncensoredfc2
    • 2021-11-26
    179 min

    [SAIT-025]Beautiful Sorceress Sakura Nose Hair Taunting. Continuous Creampie Fucking Group Show. Huge Volume Sperm Bukkake. Hiyori

  • censoredcosplaybdsmSAITtmacosplay kinbaku clubSAIT-025SAIT02555sait00025
    • 2021-12-03
    118 min

    [NNPJ-484]Eager And Easygoing - Immediate Blowjob - Abrupt Raw Fucking - Creampie Loads Are Okay! Lewd Posting On Social Media With G-cup Big Tits. Gal On Social Media - Picking Up Girls. Licking, Fondling, And Shaking While This Girl Gets Fucked For

  • censoredcreampiebig titsNNPJnampa japanNNPJ-484NNPJ484nnpj00484
    • 2021-12-05
    73 min

    444KING-058 Akari (Hayami Nana)

  • amateur censoredcreampiesquirtingkingking-058king058444king-058
    • 2021-12-30
    128 min

    [AARM-046]When This Famous Adult Video Actress With Tons Of Experience Decided To Start Working At A Men"s Massage Parlor, She Was So Sexy And Her Pheromones So Powerful That The Story Was That She Could Easily Suck The Life Out Of Her Customers

  • kobayakawa reiko akari shinmura censoredmature womanAARMaroma planningshigeo kadowakiaromaAARM-046AARM046aarm00046
    • 2022-01-01
    82 min

    563PPZ-001 Paipai Zuriko. Episode 1 [K-Cup Extreme Milk Super Nova] Sakura 22 Years Old, Omurice Shop Clerk "I Had An F Cup In 5th Grade, But When I See The Elementary School Graduate Al, It’s Really Funny, Isn’t It？ Because I’m He

  • amateur censoredbig titsamateurppzppz-001ppz001563ppz-001
    • 2022-01-05
    124 min

    [NACR-493]She Loves Cum Swallowing! A Drooling, Slobbering And Horny Girl!! Karen Asahina

  • karen asahina censoredcreampieblowjobNACRplanet plushimurokkushichi ku ryuuNACR-493NACR493h-237nacr00493
    • 2022-01-08
    122 min

    [BADA-025]Welcome, You Married Woman! Married Women Covered with Sluttiness vol. 3

  • censoredbig titsamateurBADAbaltanyuseidiamondBADA-025BADA025bada00025
    • 2022-01-08
    68 min

    C0930 tk0050 Hisako Niu 28years old

  • amateur uncensoredc0930



    • Jav Cherry, watch JAV streaming online japanese xxx