high 088




FC2JULMEYDMIAAJUFEHDKASTARSSANVEMAGMEMADNCAWDNACRBBANMVSDCESDRBDBLKMIDVMILKSHKD

2020-10-15
121 min

[ZEX-397]Fucking My Younger Stepsister Who Hated Me! After She Took An Aphrodisiac, She Sure Mellowed Out And Reversed Her Position! Mikako Abe

  • abe mikako censoredbeautiful girlsingle workZEXpeters maxZEX-397ZEX397h-720zex00397
    • 2020-10-23
    240 min

    [MBM-228]How's Your Wife？! I Can't Believe Somebody Like Her Would Cheat! I've Lost Faith In Humanity... Pretty, Prim, And Proper Wives Take Stranger's Creampies Vol. 2 12 Girls, 4 Hours

  • censoredcreampieamateurMBMprestigembmMBM-228MBM228118mbm00228
    • 2020-10-23
    245 min

    [MGT-124]Picking Up Amateur Girls On The Street Corner! vol. 93 Please Introduce Me To A Friend Who Is More Erotic Than You! 14

  • censoredcreampiesquirtingMGTprestigeno directormegatraMGT-124MGT124118mgt00124
    • 2020-10-24
    143 min

    [CAWD-128]Creampie Sugar Daddy: S*********ls In Uniform Become The Sexual Playthings Of Older Men - Suzu Nami

  • monami bell censoredcreampieuniformCAWDkawaiihiroyuki kimuraCAWD-128CAWD128cawd00128
    • 2020-11-01
    63 min

    DIZ-007 Kokoa

  • amateur censoredcreampiebig titsdizdiz-007diz007diz-007
    • 2020-11-06
    116 min

    [JUL-360]Madonna Exclusive #2! Creampie Ban Lifted! Step-mom And Step-son Go Crazy Due To A Heatwave, For Sweaty Creampie Homecoming Fakecest! Nanami Mineda

  • nanami mineda censoredcreampiemature womanJULmadonnamametaro mamezawaJUL-360JUL360jul00360
    • 2020-11-07
    126 min

    [MKON-039]My MILF Stepmom Is Young And Adorable, And Although I Could Never Tell Her In Person, I Love Her Very Much, And I Never Want Her To Remarry Ever Riho Fujimori

  • riho fujimori censoredcreampiebig titsMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-039MKON039mkon00039
    • 2020-11-12
    149 min

    1Pondo 111220_001 Hana Aoyama: Hana Aoyama Special Edition

  • amateur uncensored1pondo
    • 2020-11-13
    116 min

    [MIAA-348]Wanna Touch My H-Cup Tits？ Female Teacher Seduces A S*****t Into Cheating With A Titty Fuck - Honoka Tsujii

  • tsujii honoka censoredbig titsslutMIAAmoodyzhirokoji osakieveryone s porn starMIAA-348MIAA348miaa00348
    • 2020-11-22
    50 min

    Pacopacomama 112220_388 Manami Ueno

  • manami ueno uncensoredcreampiebig titspacopacomama
    • 2020-11-26
    217 min

    [NHDTB-461]Her Husband's Right Beside Her - Clitoral Massage Makes These Married Sluts So Horny They Can't Refuse An Egg Vibrator - Then A Cock

  • censoredbig titsNHDTBnatural highvanilla sakuraiNHDTB-461NHDTB4611nhdtb00461
    • 2020-11-29
    115 min

    [ANX-129]Hooked On Sex The Sexual Manipulation Of A Friend

  • riona suzujo kohara kihara censoredANXsaimin kenkyuujo bekkanhypno mansaimin reijo saimin kenkyu bekkanANX-129ANX129anx00129
    • 2020-12-10
    123 min

    [FGAN-029]Creampie Panties - Natsuki Natsuki Kisaragi

  • natsuki kisaragi censoredsingle workFGANfetish eyesFGAN-029FGAN029h-1440fgan00029
    • 2020-12-10
    238 min

    [PIYO-096]A Romantic Adventure For Men! A Seeking Secret Secluded Hot Spring (With Ulterior Motives)... Where Men And Women Bathe Together, Full Of Innocent Young Babes Thrilled By The Sight Of A Single Cock And Willing To Stroke It

  • censoredcreampieschoolgirlPIYOhyokopiero daPIYO-096PIYO0961piyo00096
    • 2020-12-17
    46 min

    285ENDX-321 Azato Kawaii 23-year-old OL Handsome opponent with explosive age and sensitivity and tension

  • amateur censoredcreampiesquirtingendxendx-321endx321285endx-321
    • 2020-12-21
    64 min

    SIRO-4368 [First shot] [Small face beauty with beautiful skin] [* Caution for over-erection] A foolery as if a person has changed, fascinated by a shy slender beauty. I was passed away until my head turned white .. AV application on the net → AV expe

  • amateur censoredamateursirosiro-4368siro4368siro-4368
    • 2021-01-09
    174 min

    [JUFE-245]POV Sex With Older Guys - Sweaty, Sticky, Passionate Fucks Caught On Camera Rena Momozono

  • reina taoyuan censoredcreampiebig titsJUFEfitchJUFE-245JUFE245jufe00245
    • 2021-01-15
    81 min

    [KYUN-006][Delivery Only] #I'm Kyun 006/Narumi/20 Years Old/Apparel Shop Employee

  • censoredamateurKYUNprestigekyunKYUN-006KYUN006118kyun00006
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-20
    98 min

    300MIUM-671 [Can you tear off your nipples？ ] Unexpectedly pigmented adult nipples of an unfussy office lady who works for telework in a girly room are pulled around and played with, and the unbearable man who works from home shines in the sunshine.

  • amateur censoredbig titsamateurmiummium-671mium671300mium-671
    • 2021-01-23
    143 min

    [JUL-441]She Might Be A Cougar, But She's Still Cute - She Might Be Cute, But She's Still Nasty. Natural Succubus, Man-Eating MILF Marika Kobayashi, Age 46, Makes Her Porn Debut!

  • marika kobayashi censoredmature womansingle workJULmadonnamametaro mamezawaJUL-441JUL441jul00441
    • 2021-01-29
    21 min

    495MOJ-007 Yuzuki

  • amateur censoredcreampieamateurmojmoj-007moj007moj-007
    • 2021-02-12
    315 min

    [SUPA-569]首都圏素人女子大生 5

  • censoredamateurblowjobSUPAs kyuu shiroutoSUPA-569SUPA569h-244supa00569
    • 2021-02-20
    120 min

    [NXG-360]Would You Like To Work A Part-Time Job？ We Propositioned This Elder Sister Type "We Absolutely Won't Ever Lay A Finger On You!! And We'll Pay You If You'll Hear Out Our Erotic Requests Please!!"

  • censoredamateurblowjobNXGstar paradisenext groupNXG-360NXG360h-254nxg00360
    • 2021-02-22
    61 min

    Caribbeancom 022221-001 Seductive Big Tits School Teacher Yukie Natsuki

  • yukie natsuki uncensoredcreampiehandjobcaribbeancom
    • 2021-03-04
    59 min

    1Pondo 030421_001 My girlfriend who was taken down by my father Chako Kurusu

  • amateur uncensored1pondo
    • 2021-03-26
    160 min

    [MIDE-903]I Can't Resist My S*****t's Seduction And Always End Up Fucking Her At The Love Hotel With Her After School... Nana Yagi

  • nana yagi censoredschoolgirlblowjobMIDEmoodyzsapporo taromoodyz divaMIDE-903MIDE903mide00903
    • 2021-04-03
    140 min

    [PKPD-137]Tan Punk Girl Who Has Money For Sex And Loves Getting Creampied Remon Sawa

  • sawa lemon censoredcreampiebig titsPKPDfuck group and fun friends daydreamersPKPD-137PKPD137pkpd00137
    • 2021-04-15
    130 min

    [JRZE-041]First Time Filming My Affair: Aya Kasuga

  • kasuga aya censoredcreampiemature womanJRZEcenter villagejiro fukagawajurakuJRZE-041JRZE041h-086jrze00041
    • 2021-05-14

    FC2PPV 1816869 Limited number [Uncensored] Locally quiet professional students were nasty when they took off their glasses … Stripped off the mask and made vaginal cum shot!

  • amateur uncensoredfc2
    • 2021-05-18
    139 min

    [STARS-364]Sirently Ravished - You Can't Make A Sound... You Can't Tell A Soul While She Rides You And Whispers In Your Ear, Then Makes You Cum. Mahiro Tadai

  • mahiro yui censoredbeautiful girlslutSTARSsod createhideyuki shinboSTARS-364STARS3641stars00364
    • 2021-05-21
    167 min

    [MISM-202]Crazy Obedient Masochist Sana (Fake Name) With Colossal Tits Gets Her Throat And Pussy 100 Hardcore Trained - This Dark And Moody Girl Loves Being Broken In With Perverted SM Techniques

  • censoredcreampiebig titsMISMm girls labtakuanMISM-202MISM202mism00202
    • 2021-06-01
    240 min

    [DKSB-121]Super Close-Up Angles Of Amateur Girls Enjoying Vaginal Masturbation A 4-Hour Collection

  • censoredamateurDKSBoffice k sk s bestDKSB-121DKSB12136dksb00121
    • 2021-06-10
    229 min

    [DANDY-766]This S********l Came To See Me In The Hospital And She Got Me Hard By Flashing Panty Shot Action At Me And Teased Me With A Blowjob And Made Me Cum And When My Dick Was Super Sensualized She Started Sucking On My Tip And Gave Me A Cleanup

  • censoredschoolgirlblowjobDANDYdandykenkyo momoiroDANDY-766DANDY7661dandy00766
    • 2021-06-15
    81 min

    [PPMNB-108]Being Cute Is Not Enough! Natsuki

  • censoredbig titsbeautiful girlPPMNBcranePPMNB-108PPMNB108h-706ppmnb00108
    • 2021-07-13
    43 min

    FC2PPV 1888843 [personal Shooting] Tomohame! I Took A Gonzo Like A Friend ☆ Kanade 32 Years Old ☆

  • amateur uncensoredfc2
    • 2021-08-07
    221 min

    [BAZX-300]POV Sex With A Beautiful Girl In Sailor Uniform vol. 005

  • censoredcreampiebeautiful girlBAZXk m producetodobazookaBAZX-300BAZX300bazx00300
    • 2021-08-13
    120 min

    [SSIS-152]Testing The Theory That Even A College Girl Who Hates Old Dudes Will Come Like Crazy After Spending A Month Without Sex. Sayaka Otoshiro

  • otoshiro sayaka censoredbeautiful girlsingle workSSISs1 no 1 styleasagiri jouSSIS-152SSIS152ssis00152
    • 2021-08-18
    84 min

    [ZOZO-075]A Physical Examination By An Immoral Health Care Provider Who Goes After High S*********ls - The Airi Edition -

  • censoredcreampiebig titsZOZOsadie willenauZOZO-075ZOZO0751zozo00075
    • 2021-08-20
    231 min

    [AKID-086]Take Home 6th Anniversary Work Luxury Edition @sexlife Has Started!! #takehome Vol.5 Special Edition 230 Min.

  • censoredcreampiebig titsAKIDomochikaeri mousozokumanji groupAKID-086AKID086akid00086
    • 2021-09-04
    120 min

    [NKD-280]The Fresh Face Takes It, Mugi Shinonome

  • shinonome mugi censoredsingle workNKDnakashima kougyoukanamoriNKD-280NKD280nkd00280
    • 2021-09-14
    82 min

    H0930 ki210914 Kyouko Ishinuki 27years old

  • amateur uncensoredh0930
    • 2021-10-15
    153 min

    [MIFD-184]Fresh Face 20 Years Old. She"s Good At Both Badminton And Getting Lewd! Beautiful Girl Makes Her AV Debut. Hina Kae

  • hanayo hina censoredbeautiful girlsingle workMIFDmoodyzusapyonmoodyz freshMIFD-184MIFD184mifd00184
    • 2021-10-20
    180 min

    [FUFU-202]When I Went To Get A Sensual Massage Without Telling My Wife ...

  • censoredcreampieamateurFUFUstar paradisefuufuFUFU-202FUFU202h-254fufu00202
    • 2021-11-05
    174 min

    [IPX-756]梓ヒカリの本気フェラ5分我慢できればソーププレイで完全ご奉仕します！in 渋谷

  • azusa hikari censoredbig titsblowjobIPXidea pocketkyouseitissueIPX-756IPX756ipx00756
    • 2021-11-11
    80 min

    TKK-008 Hinata Iwasaki (Rina Hinata)

  • amateur censoredcreampieamateurtkktkk-008tkk008tkk-008
    • 2021-11-13
    60 min

    [HEYZO-2651]Shiori Yamagishi Indulging In Sex With My Newly-wed Wife

  • amateur uncensoredcreampieheyzo
    • 2021-11-20
    125 min

    [CEMD-088]Nakadashi! Service Maid 2: Mei Satsuki - My Orders Are Absolute! The Body Of "Satsuki Mei" Can Be Completely Controlled!

  • satsuki mei censoredmature womanhandjobCEMDceleb no tomoCEMD-088CEMD088cemd00088
    • 2021-11-20
    151 min

    [DGCEMD-088]This Is A Special Edition! With Special Video Creampie! Maid 2: Mei Satsuki - My Orders Are Absolute! The Body Of "Mei Satsuki" Can Be Completely Controlled!

  • satsuki mei censoredmature womanhandjobDGCEMDcelebrity friendsDGCEMD-088DGCEMD088dgcemd00088
    • 2021-12-04
    235 min

    [XVSR-627]Akari Mitani. 8 Fucks x 4 Hours

  • mitani akari censoredcreampiesingle workXVSRmax amax ikacalenXVSR-627XVSR627xvsr00627
    • 2021-12-07
    92 min

    261ARA-518 [Beautiful Drawing] [Seriously Pure] Mai-Chan Is Here! Free Illustrator Interviews For AV Shooting! The Interview Is About Stretching Your Body W [Restricted Play] [Panting] I Keep Panting Until The Beginning Or The End In The Abnormal Pla

  • amateur censoredamateuraraara-518ara518261ara-518
    • 2021-12-18
    148 min

    [FCDC-140]Imai Natsuho Is A Slutty Secretary Who Seduces Her Employees With Her Big Ass And Nipples.

  • natsuho imai censoredslutsingle workFCDCweekenderFCDC-140FCDC140fcdc00140
    • 2021-12-20
    59 min

    328HMDN-437 [Individual] H Cup Forty Slender Married Woman Too Beautiful Female President Personal Shooting That Goes Crazy For Raw Sex With A Salesman Leaving The Home (Nanao Nakano)

  • amateur censoredcreampiebig titshmdnhmdn-437hmdn437328hmdn-437
    • 2022-01-03
    88 min

    FC2PPV 2567724 ☆ First Shot ☆ Complete Appearance ☆ 148cm Small Loli Body ♥ Plenty Of Vaginal Cum Shot In A Baby-Faced Beautiful Girl’s Kitsman ♥ [Personal Shooting]

  • amateur uncensoredfc2
    • 2022-01-28
    128 min

    [VOD-006]The Second Document Of A Real Amateur Wife, 100cm K-cups Glossy With Lustful Tongue Kisses And Sweat... First Continuous Creampie 3p Sex Warm Hibino

  • hibino wen censoredcreampiebig titsVODvenuskaniereality venusVOD-006VOD006vod00006
    • 2022-01-28
    45 min

    [544IDJS-052]ゆか (20) 若干ハタチの猛者降臨

  • amateur censoredamateuridjsidjs-052idjs052544idjs-052



    • Jav Cherry, watch JAV streaming online japanese xxx