high 035




FC2MVSDVENXNACRHDKAKBIMIDVFSDSSPPPDMIDEPREDSSISMIAAMILKBBANDTTSANCJODSHKDSDABJUL

2020-12-08
69 min

FC2PPV 1598805 Public general course J cup K ● 3 years M-chan consented to NN for boyfriend whose income dropped sharply

  • amateur uncensoredfc2
    • 2020-12-12
    34 min

    FC2PPV 1603485 [Men’s Hidden Shooting] Bangs Straight Bangs Beautiful Girl Minami-chan (18) It’s OK to go out with a desire for pocket money and it’s a vaginal cum shot from a promise

  • amateur uncensoredfc2
    • 2020-12-18
    230 min

    [PARATHD-3062]Testing If Female Masseuses At Different Business Hotels Across The Country Will Let You Fuck Them？ 4 Hour Special (2) Nagoya, Shizuoka, Nagano, Sendai, Niigata, Toyama Edition

  • censoredbig titsuniformPARATHDparadise tvPARATHD-3062PARATHD3062parathd03062
    • 2020-12-23
    36 min

    FC2PPV 1617261 A young wife who breaks pantyhose while fighting with her husband and immediately blows and immediately squirts and panting with continuous vaginal cum shot! Put out a lot of things that you can know as a dangerous day

  • amateur uncensoredfc2
    • 2020-12-24
    170 min

    [NHDTB-473]She Got Her Cunt Pumped With Furious Piston-Pounding Strokes, And She Came While Overflowing With Pussy Juices And Giving Deep Throat Blowjobs! Sensual Woman Who Experience F***eful Perversion Awakenings

  • censoredblowjobNHDTBnatural highvanilla sakuraiNHDTB-473NHDTB4731nhdtb00473
    • 2021-01-01
    99 min

    [VEC-458]I Took The Hot Married Woman At My Part-Time Job Home For Creampie Sex Mako Oda

  • oda mako censoredcreampiebig titsVECvenusbingo tamatsukamegami venusVEC-458VEC458vec00458
    • 2021-01-15
    329 min

    [YPTS-001]True Stories! Sugar Daddy Insertion: Amateur POV Leaked Pictures

  • censoredcreampiebig titsYPTSpetersYPTS-001YPTS001h-021ypts00001
    • 2021-01-24
    36 min

    285ENDX-325 Pinch the nipple strongly! Frustration is here with an unstoppable hip swing! Eliminate as soon as possible! ？？ Firm hold SEX!

  • amateur censoredcreampieamateurendxendx-325endx325285endx-325
    • 2021-01-31
    45 min

    493PKPD-085 [Leak] Picked up huge breasts JD and vaginal cum shot & squirting FU ○ K

  • amateur censoredcreampiesquirtingpkpdpkpd-085pkpd085493pkpd-085
    • 2021-02-09
    126 min

    [KTRA-274]Innocent Stepdaughter Creampied Karen Junshin

  • junshin karen censoredsoloworkKTRAk tribeKTRA-274KTRA274
    • 2021-02-12
    151 min

    [SCPX-418]Reverse Cuckold By A Beautiful Neighborhood Mom.

  • censoredcreampieblowjobSCPXscoopmousouzokuSCPX-418SCPX418h-565scpx00418
    • 2021-02-17
    481 min

    [RVG-129]"My Dick Is In Her Raw!" She Was Giving Me An Oily Pussy Grind But When My Cock Was Rubbing Up Against Her Pussy It Just Slipped Right In! This Service Didn't Allow Real Fucking But This Horny Delivery Health Call Girl Ended Up L

  • censoredcreampieRVGglory questRVG-129RVG12913rvg00129
    • 2021-02-18
    119 min

    [SSNI-999]Sexy Costume Non-Nude Erotica Star Akua Yamazaki Can't Resist Her Gropers... Barely Legal Teen Ravished In 5 Situations

  • mizuyama yamazaki censoredbig titsbeautiful girlSSNIs1 no 1 stylekyoseiSSNI-999SSNI999ssni00999
    • 2021-02-19
    223 min

    [SIM-109]My Super Young Stepmom Is A Total Slut - She's Down To Fuck Her Stepson Any Time He Wants

  • censoredcreampieSIMprestigeamateur pussiesSIM-109SIM109118sim00109
    • 2021-03-04
    59 min

    FCP-003 [Delivery only] Completely subjective! !! G cup or more that completely wraps Ji ● Ko … Superb big tits fucking ＃ 3

  • amateur censoredbig titsamateurfcpfcp-003fcp003fcp-003
    • 2021-03-05
    80 min

    [ZOZO-058]The New Female Teacher: Nozomi Higashi's Shame! Sexual Education At An All-boys' School

  • censoredcreampiebig titsZOZOsadie willenauZOZO-058ZOZO0581zozo00058
    • 2021-03-06
    239 min

    [HUNTA-960]"Please Stop! I'm Cumming So Much I Think I'm Going To Lose My Mind!" My Little Stepsister Was Thrusting Out Her Tight, Godly Ass, And I Could No Longer Resist ... So I Entered Her Raw, From Behind! And Then I Pumped Her Wi

  • censoredcreampieschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-960HUNTA960hunta00960
    • 2021-03-18
    117 min

    [BLK-492]Chubby Slut Sucks On Older Rich Man's Nipples On A Sexy Cum Journey!

  • censoredbig titsblowjobBLKkira kirakira kira black galBLK-492BLK492blk00492
    • 2021-03-18
    133 min

    [JMTY-048]I Love Older Men [Limited] AV Interview - Aya Shiomi

  • aya shiomi censoredamateurJMTYteacher delusion groupjackson stone bridgeJMTY-048JMTY048jmty00048
    • 2021-03-21
    120 min

    [JUL-507]The Story Of How I Spent Three Days Lovingly Fucking My Now Married Former Classmate When Visiting My Hometown Marina Shiraishi

  • rena shiraishi censoredbig titsmature womanJULmadonnajo asagiriJUL-507JUL507jul00507
    • 2021-03-23
    133 min

    [KUSE-010]"I Wanna Be A Cum Dumpster" Slender, Baby-Faced Cutie Wants Men To Make Her Dirty - Buckets Of Cum Swallowing From A True Sub Servant - Inori Sasage, Age 23

  • dedication glue censoreddeepthroatsingle workKUSEsod createevening editionthis actress style is amazingKUSE-010KUSE0101kuse00010
    • 2021-04-30
    62 min

    FC2PPV 1795216 Limited to 200 pieces, 1280 PT! [No individual shooting, premier beautiful girl, full-scale blowjob, cum swallow] Finally, that beautiful girl Serika-chan has arrived! I faint in agony with Perojupa who is too cute! With a smile, IR

  • amateur uncensoredfc2
    • 2021-05-01
    141 min

    [BBAN-326]Lesbian Couples That Get Turned On By Swapping. I Get So Wet When Somebody Else Touches My Girlfriend's Body... Himari Kinoshita Suzu Monami

  • himari kinoshita himari hanazawa monami bell censoredlesbianBBANbibianBBAN-326BBAN326bban00326
    • 2021-05-17
    102 min

    300MIUM-699 F Cup Beautiful Girl Still Growing! !! A refreshing fashion beautiful girl OL and a rhythmic gymnastics-prepared flexible body! I definitely want to conceive it! !! The best compatibility ● I’m sorry for the semen seeded in the po-me

  • amateur censoredcreampiebig titsmiummium-699mium699300mium-699
    • 2021-05-20
    152 min

    [FSDSS-232]Amateur Real Life College Girl Is Interested In The World Of Porn Rin Natsuki Porn Debut

  • rin natsuki censoredbig titsbeautiful girlFSDSSfalenosatoshi maedafaleno starFSDSS-232FSDSS2321fsdss00232
    • 2021-05-28
    72 min

    300NTK-577 Raw chin raw insertion in the pool of the example with a beautiful girl raw distributor who is too cute! !! The pant voice of Kansai lead that leaks involuntarily with raw piss is evidence of a live reaction! ？？ Of course, the finale is fu

  • amateur censoredcreampieamateurntkntk-577ntk577300ntk-577
    • 2021-06-05
    242 min

    [BUR-572]Video Recording A Stepfather's Temptation To Have Some Family Fun With His Stepdaughter While Mom Is Away - 4 Hours

  • censoredcreampiebeautiful girlBURgraysburstBUR-572BUR57212bur00572
    • 2021-06-10
    124 min

    [FSDSS-235]Romantic Cohabitation Sex! French Kissing With Flirty Hot Girl Teacher Momo Honda

  • honda peach censoredsingle workFSDSSfalenoboomer 44faleno starFSDSS-235FSDSS2351fsdss00235
    • 2021-06-12
    237 min

    [XRLE-004]Mouthpussy Creampie - Breaking In A Beautiful Girl With Deep Throat Face Fucks Nozomi Arimura

  • arimura nozomi censoredbeautiful girldeepthroatXRLEreal worksani nakamurareal real worksXRLE-004XRLE004xrle00004
    • 2021-06-18
    73 min

    [SS-026]Lovin' You Yu Shinoda

  • ai uehara yoshinaga akane censoredcreampiebig titsSSplumSS-026SS02613ss00026
    • 2021-06-24
    61 min

    1Pondo 062421_001 Home visit sexual intercourse with a teacher Rino Sakuragi

  • amateur uncensored1pondo
    • 2021-06-26
    108 min

    [VEC-482]Sharing A Secret With My Friend's Mom I Can't Tell Anyone I Came Inside My Friend's Mom... Michiru Kujo

  • kujo michiru censoredcreampiemature womanVECvenussarumegami venusVEC-482VEC482vec00482
    • 2021-07-01
    103 min

    [IQQQ-025]A Married Female Teacher Who Gets 10 Times Wetter In A Climax Class Where You Can't Make A Noise - Chitose Yuki

  • chitose in the evening censoredcreampiemarried womanIQQQcenter villagesouthern earthzora center villageIQQQ-025IQQQ025h-086iqqq00025
    • 2021-07-05
    81 min

    493NAEN-065 [Outflow] Ginza hostess pillow business! Rio Sakagami who violently commits the highest sensitivity Ginza Mako

  • amateur censoredamateurbeautiful girlnaennaen-065naen065493naen-065
    • 2021-07-09
    149 min

    [MIDE-948]Guided To An Elegant Orgasm Through Mature, Sensual Techniques - In-Home Brothel Rikka Ono

  • rokka ono censoredblowjobbeautiful girlMIDEmoodyzdragon nishikawamoodyz divaMIDE-948MIDE948mide00948
    • 2021-07-14
    66 min

    494SIKA-100 Revenge On Your Boyfriend! Look At Me Squirming With Another Stick

  • amateur censoredcreampieamateursikasika-100sika100494sika-100
    • 2021-07-18
    242 min

    [NASH-541]Sixty Something Grandma's Creampie From Her Step-Grandson's Giant Cock Reminds Her Of Orgasmic Delights She'd Almost Forgotten 3

  • saho imaizumi miyagi kanako censoredcreampiemature womanNASHnadeshikojun nagasawaNASH-541NASH541nash00541
    • 2021-07-22
    182 min

    [MIAA-479]Super Masochistic Girl Is Adorable Trying To Seduce A Man For The First Time...I Returned The Favor 100-Fold By Fucking Her Hard And Cumming Inside Her! Mai Kagari

  • flower hunting censoredcreampiebeautiful girlMIAAmoodyzusa pyoneveryone s porn starMIAA-479MIAA479miaa00479
    • 2021-07-29
    61 min

    SIRO-4582 [First Shot] [Temptation E Breast Fucking] [Waist Swing Masturbation Cowgirl] E-Cup Female College Student With Outstanding Sensitivity That Is Still Growing. She Shows Off The Finest Full-Course Service Using Beautiful Big Tits, And If A R

  • amateur censoredbig titsamateursirosiro-4582siro4582siro-4582
    • 2021-08-21
    120 min

    [SMCP-001]My Wild Idea Of A Gentleman"s Adventure Came True! Mating As Much As I Want With A Little Pussy In Heat! Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcosplaysingle workSMCPsmartmedia production mousouzokumaruchi vitaminSMCP-001SMCP001smcp00001
    • 2021-08-31
    42 min

    H0930 ki210831 Ran Kato 39years old

  • amateur uncensoredh0930
    • 2021-09-11
    245 min

    [MDTE-015]A Highly Educated College Girl With Loose Morals Goes Hunting For Sugar Daddies To Satisfy Her Lust, Filmed In 4 Hours Of Creampies 5

  • censoredcreampiebig titsMDTEspace planningtetMDTE-015MDTE015mdte00015
    • 2021-09-11
    240 min

    [270JGAHO-255]いまだに現役ヤリマンママの息子喰い 白石潤 吾妻かおり 神崎久美 樋口幹恵

  • amateur censoredmarried womanamateurjgahojgaho-255jgaho255270jgaho-255
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-11
    114 min

    [GS-410]Miniskirt Reception Girl Of My Dreams Lovingly Takes My Soaking Dick In Her Mouth. Such A Beauty That My Heart Pounds Every Time I See Her. Such A Precious Flower Who Would Never Normally Turn Her Eye To A Useless Employee Like Me. One Day Wh

  • censoredblowjobGSsosoru garconreddo bo ruGS-410GS4101gs00410
    • 2021-11-11
    107 min

    [SPRD-1481]Fucking Daughter"s Mate Chisato Shoda

  • shota chisato censoredsingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1481SPRD148118sprd01481
    • 2021-11-13
    134 min

    [MOPT-013]The Best Masochistic Sex Service That Keeps Masochistic Men On Verge of Ejaculation By Constantly Pulling Out. Iroha Minami

  • minami iroha censoredanalblowjobMOPTm o paradisemo tightMOPT-013MOPT013mopt00013
    • 2021-11-18
    63 min

    10musume 111821_01 Putting The Showa Style’s Gym Clotes Bloomers On And Get Laid Reina Oume

  • amateur uncensored10musume
    • 2021-11-19
    210 min

    [ROYD-073]Slut Friends Cum Together - Hard! Horny Nymphos Devour Your Cock... Minami Hatsukawa Yu Shinoda

  • hatsukawa minami shinoda yu censoredmomROYDroyalmorikihhh groupROYD-073ROYD073royd00073
    • 2021-11-25
    200 min

    [SW-813]C***dhood Friend With A Knee-high Stocking S********l Outfit Gives A Panty Shot, And I Got To See Her Thighs And Panties! She Has Liked Me For A Long Time It Seems, And Hearing Her Cutely Confess Her Feelings Got My Dick So Hard!

  • censoredschoolgirlSWswitchraito fuji makotoswitch hibinoSW-813SW8131sw00813
    • 2022-01-15
    120 min

    [GVH-349]My Mother-in-law Is Just Too Lewd - A Son-in-law Who Goes After Big Tits - Rin Okae

  • rin okae censoredcreampiebig titsGVHglory questkabin kizakuraGVH-349GVH349gvh00349
    • 2022-01-21
    137 min

    [JUL-848]A Coincidental Reunion At A Deli With A Sexually Harassing Teacher From Her School Days. From That Day On, He Makes Her His Pet For Sex... Ichika Matsumoto

  • ichika matsumoto censoredmature womansingle workJULmadonnashiro shotenJUL-848JUL848jul00848
    • 2022-01-21
    29 min

    FC2PPV 2608267 Insanely Cute [Sister Can System] I Invited An Amateur Student To Drive At Night And Made Him Blow In The Car! Turn Into A Private Suite Room With No Hand Blow Job

  • amateur uncensoredfc2
    • 2022-01-26
    29 min

    FC2PPV 2624852 I’m Cheering For The Hotel Alone With That Child Of The Cafe Part-Time Job

  • amateur uncensoredfc2
    • 2022-02-10
    117 min

    [IENF-193]I Was Pulling Pranks On My S******g S********l Little Sister, But Then She Started Demanding A Raw Fuck, And I Wanted To Unload My Cum, But She Locked Her Legs Around Me In A Crab Hold And Kept Me There Until I Had To Creampie Her! 6

  • momose asuka amu ohara censoredcreampieschoolgirlIENFienergyienfIENF-193IENF1931ienf00193
    • 2022-02-18
    134 min

    489IKUIKU-009 Yui (20) ・ Minami (19)

  • amateur censoredcreampiesquirtingikuikuikuiku-009ikuiku009489ikuiku-009



    • Jav Cherry, watch JAV streaming online japanese xxx