gone 055




FC2PREDSTARSNACXSPRDVEMAHDKAMIDEMIDVMEYDSSNIIPXBLKSSISCESDATIDVENUEBODVENXMVSDSHKD

2020-09-04
150 min

[HODV-21507]Welcome To The Temptation Clinic - Reika Hashimoto

  • reika hashimoto censoredsquirtingsingle workHODVh m pHODV-21507HODV215075642hodv21507
    • 2020-09-04
    64 min

    300NTK-426 Burning Unfaithful Intercourse! ？ A Storm Of Service For A Lustrous Yandere Beauty! !! The Aim Is A Daytime Date From Breaking Away From The Second Woman! !! Immediately! !! Immediate Scale! !! Insert Immediately! !! 3 Immediately Rich Pro

  • amateur censoredcreampieamateurntkntk-426ntk426300ntk-426
    • 2020-09-05
    148 min

    [SSNI-857]I'm Having Titty-Jiggling Power Piston-Pumping Sex Over And Over With A Natural Airhead Big Tits Girl Who Is Unwittingly Tempting Me With Her Clothed Big Tits And Cumming Again And Again Miharu Usa

  • miharu hanasaki censoredbig titssingle workSSNIs1 no 1 styleichigoharaSSNI-857SSNI857ssni00857
    • 2020-09-10
    65 min

    336KNB-120 My cheating husband didn’t deal with me … To heal the lonely heart of a young wife! I’m a shy person, but when it comes to SEX, I’m boldly crazy and lewd! From now on I will take a gonzo with this married woman. 16 at M

  • amateur censoredmarried womanamateurknbknb-120knb120336knb-120
    • 2020-09-14
    65 min

    [orec-571]りか

  • amateur censoredcreampiebig titsorecorec-571orec571orec-571
    • 2020-10-10
    159 min

    [JUFE-212]A Video Record Of Warped Love A Plain Jane Female S*****t With Big Tits Gets Domestication Breaking In Training For 20 Days Until She Descends In Orgasmic Pleasure Hinata Koizumi

  • hinata koizumi censoredbig titsbeautiful girlJUFEfitchJUFE-212JUFE212jufe00212
    • 2020-10-18
    105 min

    [VENU-971]I Mistook My Mother-In-law's Booty For My Wife's And Slipped My Cock Inside Her! Yu Shinoda

  • shinoda yu censoredcreampiebig titsVENUvenuspeterfakecest winntersVENU-971VENU971venu00971
    • 2020-10-25
    53 min

    326HGP-003 [Abnormal squirting] The momentary gal who lives in the seaweed is an ∞ squirting monster! !! Bringing a hotel from a drunken street in the middle of the day ⇒ Leaking without permission ⇒ Incontinence following incontinence ⇒ Fainting kno

  • amateur censoredcreampiebig titshgphgp-003hgp003326hgp-003
    • 2020-11-02
    54 min

    188HINT-0426 Kana

  • amateur censoredmarried womansquirtinghinthint-0426hint0426188hint-0426
    • 2020-11-21
    24 min

    H4610 ki201121 piddle

  • amateur uncensoredh4610
    • 2020-12-10
    93 min

    [OKB-101]Plump Big Asses In Gym Shorts - Petite Beautiful Girl Shizuku Asahi And Chubby Girls Put On Tight Gym Shorts And Sportswear, And Filmed Close-Up Revealing Their Panties Sticking Out And Showing Their Cracks So Clearly You Can Almost See The

  • asahi dro censoredOKBpersonal photography of fathergod bulmaOKB-101OKB1011okb00101
    • 2020-12-11
    54 min

    FC2PPV 1602707 Overwhelming beautiful girl Ami-chan once in 100 years ❤️❤️ The first position in my life is also good with all my strength and at the end … [Personal shooting]

  • amateur uncensoredfc2
    • 2020-12-22
    140 min

    [STARS-309]Practicing Making Babies With My C***dhood Friend - Creampie Sex. Suzu Honjo

  • suzu honjo censoredcreampiesingle workSTARSsod creategoemonsod starSTARS-309STARS3091stars00309
    • 2020-12-22
    61 min

    HEYZO 2421 Exploring Every Corner Of A Cute Girl! – Sena Kusunoki

  • sena kusunoki uncensoredcreampieheyzo
    • 2020-12-27
    254 min

    [GAID-013]Fairy Tale BEST

  • ichika matsumoto nene tanaka censoredbig titsbeautiful girlGAIDfirst starbirdman teppeiaida first starGAID-013GAID013h-491gaid00013
    • 2021-01-09
    120 min

    [MIDE-873]Her Lust Is Off The Charts! She Hasn't Gotten Laid In 30 Days And Now She's Desperate To Get Fucked - Raging Horny Slut At A Hot Spring Ibuki Aoi

  • aoi ibuki censoredbig titssingle workMIDEmoodyzmichiru arashiyamamoodyz divaMIDE-873MIDE873mide00873
    • 2021-01-09
    129 min

    [DASD-797]Saliva And Legs Entwined. Single Night Of Raw Lust. "Tanned Young Married Woman Cheats On Her Husband" REMI

  • remi censoredbig titssingle workDASDdasrokusaburo mishimaDASD-797DASD797dasd00797
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-20
    87 min

    [KIR-026]My Wife's Sister Visited Me From The Country, But My Wife Came Home... Yuka Hoshi

  • yuka hoshi censoredcreampiebig titsKIRstar paradisekirei star paradiseKIR-026KIR026h-254kir00026
    • 2021-01-23
    150 min

    [HND-936]Fresh Face: The No. 1Man-Eater In Asia! This Half-Japanese 6' Knock-Out Babe Makes Her Creampie Debut! By Day She's A High-Powered Career Woman Working For A Foreign Investment Group, But By Night She's A Cock-Loving Wild Kinky S

  • maryjun kinoshita censoredcreampiesingle workHNDhon nakamichiru arashiyamaHND-936HND936hnd00936
    • 2021-01-30
    56 min

    C0930 ki210131 Mai Katagiri 26years old

  • amateur uncensoredc0930
    • 2021-02-06
    21 min

    C0930 ki210206 piddle 20years old

  • amateur uncensoredc0930
    • 2021-02-13
    112 min

    [APNS-227]Shameful Home Visit - Karen Otoha

  • karen otoha censoredcreampiedramaAPNSaurora project annexnasunohiroAPNS-227APNS227apns00227
    • 2021-02-17
    39 min

    [sika-042]あいちゃん 2(18)

  • amateur censoredschoolgirlamateursikasika-042sika042sika-042
    • 2021-02-19
    120 min

    [AQSH-065]Careless Wives On Skype - My Busty Neighbor Has Fallen Into My Trap... Hana Himesaki

  • himesaki hana censoredcreampiebig titsAQSHaquamall heroaquamallAQSH-065AQSH065aqsh00065
    • 2021-02-19
    113 min

    [HZGD-178]"Dear, I Love You ..." In Order To Satisfy His NTR Urges, He Started Offering Creampie Services At His Beauty Salon, And Put His Beloved Wife Out To Service His Customers Mami Nagase

  • asami nagase censoredcreampiebig titsHZGDmarried woman flower garden theaterzampaimage married woman flower garden theatHZGD-178HZGD178h-1100hzgd00178
    • 2021-02-20
    55 min

    FC2PPV 1694999 First shot ★ 155 cm 80 kg Her flesh is A5 rank certified ♥♥ I was too sensitive to sex after a long time and my white eyes were messed up www

  • amateur uncensoredfc2
    • 2021-02-27
    39 min

    [HHKL-087]I Fucked My Sister In Law Who Was Sick And Tired Of Waiting For Her Workaholic Husband Select 2 Konoha Narumi

  • narumi koku censoredcreampiebig titsHHKLhunterkawajirihhh groupHHKL-087HHKL087hhkl00087
    • 2021-03-13
    137 min

    [AVSA-159]A New Generation Bisexual Pleasure-Seeking Absolutely Assertive Cute She-Male A Cross-Dressing Babe x A Beautiful Lesbian x A Big Dick Breaking In Master

  • mayuri takigawa akane shiki censoredlesbianbdsmAVSAavs collector ssanpei yuyuavscollector sAVSA-159AVSA159avsa00159
    • 2021-03-19
    142 min

    [TNOZ-003]Titanic Tits: Rural Cosplayer (Age 19) With A Submissive Streak (Everybody Gets A Titty & Nipple Fuck & Cums On Her Tits) P-Cup With Enormous Nipples Ravished By 12 Continuous Loads In A Titty Fuck Four-Some Orgy, Spitroasted By 2 Guy

  • censoredbig titscosplayTNOZall japan amateur photographers union daspit uncle 2 all japan kameko cooperatiTNOZ-003TNOZ003tnoz00003
    • 2021-03-20
    87 min

    [VNDS-3362]I Can't Tell My Husband Until The Day I Die... Forty Something Wife Fucked By Her Step Son Hitomi Oshima 40 Years Old

  • hitomi kojima censoredbig titsmature womanVNDSstar paradisenext toilet r eVNDS-3362VNDS3362h-254vnds03362
    • 2021-03-20
    68 min

    476MLA-015 The figure body with outstanding style is continuously ○! !! Astonished at the masterpiece cowgirl of a neat and clean bitch caught by a diet monitor bite ww

  • amateur censoredcreampieamateurmlamla-015mla015476mla-015
    • 2021-04-03
    139 min

    [DNJR-047]Youthful Foot Academy Going Crazy From Feet That Smell Like The Ripe Sour Scent Of Youth

  • riko sato otohana eve censoredslutDNJRdog daydreamersmaboroshikoDNJR-047DNJR047dnjr00047
    • 2021-04-20
    65 min

    200GANA-2470 In the spear room of the Nampa teacher of 100 battles, bring in SEX hidden shooting 201 Bring a girl who became friends to the house and massage! Fir fir to the point where you do not have to rub … Naturally to erotic development! T

  • amateur censoredamateurganagana-2470gana2470200gana-2470
    • 2021-05-12
    110 min

    459TEN-018 [The strongest erotic ass in history] Assault on the home of Miss F milk cabaret captured in Ebisu! !! Bombshell fuck with a special game underwear for gals! !! Poke the peach butt of the prepuri and poke it! !! Raw vaginal cum shot to the

  • amateur censoredcreampiebig titstenten-018ten018459ten-018
    • 2021-05-28
    121 min

    [WAAA-065]Shooting Cum Inside Of Her After She's Already Orgasmed! Moa Maeda

  • maeda momoko censoredcreampiebig titsWAAAwanz factorywanzWAAA-065WAAA065waaa00065
    • 2021-05-28
    41 min

    [HEYZO-2541]Darcia Creampie in Europe ＃Darcia3

  • darcia uncensoredheyzo
    • 2021-07-09
    172 min

    [JUFE-305]Contrary to Her Cool Appearance, She is Weak When Pushed and Has Excellent Sensitivity! A Raunchy Climax Debut Charmed by an Active Lingerie Model with a Body Line that is Too Beautiful.

  • censoredcreampiebig titsJUFEfitchJUFE-305JUFE305jufe00305
    • 2021-07-13
    60 min

    H4610 ki210713 Nanako Shirai 20years old

  • amateur uncensoredh4610
    • 2021-07-15
    120 min

    [AQSH-072]They Came Down From The High Of Their Trip To Hawaii When She Found Out That Her Husband's Company Was About To Go Down Under! After Deliberating How To Raise Funds, The President's Wife Decided To Sell Her Tanned Body To The Highes

  • remi censoredcreampiemature womanAQSHaquamall heroaquamallAQSH-072AQSH072aqsh00072
    • 2021-07-22
    205 min

    [SVDVD-871]A Sexual Experiment Featuring College Girls! If You Can Make A Guy Cum With A Sheet Of Plastic Wrap Between His Cock And Your Pussy, You Win $10,000! - The Wrap Starts To Slip, And His Cock Gets Harder When It Touches Her Bare Pussy! She F

  • censoredcreampiesquirtingSVDVDsadistic villagekannana dainanaamateur variety showSVDVD-871SVDVD8711svdvd00871
    • 2021-07-30
    213 min

    [HUNTB-065]"What Are You Doing In The Classroom？ Camping？ Can We Join In？" Close Fucking Sex In A Cramped Tent! The Pinnacle Of Youth With 5 Girls And I! Classroom Camping!

  • censoredcreampieschoolgirlHUNTBhuntermorikihhh groupHUNTB-065HUNTB065huntb00065
    • 2021-08-18
    480 min

    [RVG-138]Pussy Bondage Device Steel Bonday Pussy Teasing Highlights vol. 2

  • mizuki yayoi yui nagase censoredRVGglory questRVG-138RVG13813rvg00138
    • 2021-09-02
    75 min

    FC2PPV 2089132 [Leaked] Girls Band Vocal K (20) Boyish Big Breasts Diva’S Private Girl’s Face Creampie Gonzo Leaked [Personal Shooting]

  • amateur uncensoredfc2
    • 2021-09-19
    79 min

    522DHT-0302 Living In Minami Aoyama X 3rd Year Marriage Big Breasts Wife Creampie Her Kana 30 Years Old

  • amateur censoredbig titsmarried womandhtdht-0302dht0302522dht-0302
    • 2021-09-23
    122 min

    [DLDSS-026]Mission: Cumpossible The Soothing Semen Hunter Rin Azuma

  • dongguan censoredblowjobsingle workDLDSSdahliajounetsu yakaraDLDSS-026DLDSS0261dldss00026
    • 2021-09-24
    35 min

    FC2PPV 2244422 Ejaculate In "Nothing" Panties! !! Baby-Faced Girls Who Remain Young ● Enjoy Raw Pink Panties With Stains! Panchira, M-Shaped Spread Legs, Face Sitting, Pankoki … At The End, It Gets Dirty With Thick Semen.

  • amateur uncensoredfc2
    • 2021-09-24
    111 min

    [VENX-076]My Hot Stepmom Is Left At Home When Dad Is Away On Business Trip. Now She Gets Non-stop Creampie Action. Ruka Aise

  • ruka aise censoredcreampiemature womanVENXvenuspe taincest vi nasuVENX-076VENX076venx00076
    • 2021-10-01
    151 min

    [CAWD-293]"Never Should Have Made You Celibate!" Throw Out All The Rules And Script! All The Fucking You Could Ever Want. Hana Shirato And Meru Ito. Sexy Plan To Turn Them Into Horny Sluts.

  • ito meru white peach censoredcreampieslutCAWDkawaiiCAWD-293CAWD293cawd00293
    • 2021-10-16
    109 min

    [GTJ-097]The Innocent Sex Doll, Nana Maeno

  • nana maeno censoreddeepthroatbdsmGTJdogmatohjirogold tohjiro labelGTJ-097GTJ097gtj00097
    • 2021-10-21
    72 min

    10musume 102121_01 Massuse Scammer Persuades The Innocent Girl To Have Sex That Sex Is An Outstanding Effect For Losing Weight Mei Nozomi

  • amateur uncensored10musume
    • 2021-10-23
    240 min

    [OKAX-783]Normal Wife Duped By Husband To Visit His Friend, Leading To Cheating Fuck! 4 Hours

  • censoredamateurmature womanOKAXk m producedick mandokuokazuOKAX-783OKAX783okax00783
    • 2021-10-26
    16 min

    FC2PPV 2374034 [Individual] Thirty Wife In Kyushu. She Is Raped By Another Stick Instead Of Her Husband’s Debt, And She Is Drowned In Pleasure And Faints In Agony And Is Facially Shot.

  • amateur uncensoredfc2
    • 2021-10-30
    125 min

    [GVH-314]Breaking In the Honor S*****t. A Pregnancy Training Camp Acting Like a Slut. Rina Takase

  • rina takase censoredcreampieschoolgirlGVHglory questkimura hajimeGVH-314GVH314gvh00314
    • 2021-11-04
    140 min

    1Pondo 110421_001 Mihono, Sara Saijo : Sexy Actress Special Edition

  • amateur uncensored1pondo
    • 2021-11-11
    104 min

    [SPRD-1482]Creampie with Step-mother Mitsuyo Ikuno

  • mitsuyo ikuno censoredcreampiemature womanSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1482SPRD148218sprd01482



    • Jav Cherry, watch JAV streaming online japanese xxx