facial over hours big tits censored javcensored




FC2LULUSANMIDVHDKAATIDDTTSQTEFSDSSSTARSDASDWANZMIDESSISGVHSHKDMILKRBDCESDBLKKSBJ

2020-09-13
41 min

230ORE-688 Alice

  • amateur censoreduniformschoolgirloreore-688ore688230ore-688
    • 2020-09-17
    118 min

    [SSNI-869]Newlywed NTR At The Family Home I Met My Asshole Ex-Boyfriend, Whom I Broke Up With 5 Years Ago, When I Visited My Family In The Country. I Would Have Never Imagined That I Would Commit Adultery With This Piece Of Shit, Or That It Would Be

  • ichika hoshimiya censoredsingle workSSNIs1 no 1 stylerakudaSSNI-869SSNI869ssni00869
    • 2020-09-23
    75 min

    374SHOW-027 Mika

  • amateur censoredbig titsamateurshowshow-027show027374show-027
    • 2020-10-30
    113 min

    [RD-1023]Erotic Showa Drama - Second Wife Ravished By Her Father-In-Law - Poor Farmer's Wife Seduced By Her Landlord's Son

  • misato shibasaki reiko kasumi censoredmarried womanblowjobRDathena videomurayamaathenaRD-1023RD1023149rd01023
    • 2020-11-02
    64 min

    188HINT-0423 Miyuki

  • amateur censoredmarried womanamateurhinthint-0423hint0423188hint-0423
    • 2020-11-06
    122 min

    [PRED-265]Let A Woman Handle Things And You'll Be Rewarded With The Pleasure Of Ejaculation! Enjoy 3 Days Of Cowgirl Sex As Your Elder Sister-Type C***dhood Friend Suck And Slurp All Of Your Semen For 3 Days Straight Yu Shinoda

  • shinoda yu censoredcreampieslutPREDpremiumeightelegancePRED-265PRED265pred00265
    • 2020-11-17
    47 min

    330PER-334 Rina

  • amateur censoredamateurperper-334per334330per-334
    • 2020-11-26
    54 min

    413INST-073 [4P orgy / individual shooting] Neat and clean little bitch Ichika-chan, 25 years old. A beautiful accounting who eats a man with a cute technique of killing a father inserts a pick-up cock firmly! Squeeze raw semen with pie bread! 【amate

  • amateur censoredcreampieamateurinstinst-073inst073413inst-073
    • 2020-12-13
    70 min

    SIRO-4355 [First shot] [Style that is as good as a model] [Sensitive body that leans back] A tall and preeminent style nurse egg. A mysterious girlfriend with a magical charm that makes you want to hold it many times .. AV application on the net → AV

  • amateur censoredamateursirosiro-4355siro4355siro-4355
    • 2020-12-26
    123 min

    [MIAA-370]In Our Dorm, Across From My Room, Lives My Favorite Big Tits Female Teacher I Was Secretly Enjoying Myself, Peeping On Her, But Ever Since That Day, When She Caught Me... She Began To Escalate The Titty Temptation And When I Could No Longer

  • tsujii honoka censoredcreampiebig titsMIAAmoodyzhiroyuki kimuraeveryone s porn starMIAA-370MIAA370miaa00370
    • 2021-01-09
    30 min

    279UTSU-486 Ruru

  • amateur censoredcreampiebig titsutsuutsu-486utsu486279utsu-486
    • 2021-01-17
    302 min

    [LZBS-067]The Top 24 Anal-Loving Lesbians In The Biz! 5-Hour Select BEST Collection - Big Booty Babes VS Anal Sex

  • mitani akari otsuki sound censoredanallesbianLZBSlesrebest lesbian playLZBS-067LZBS067lzbs00067
    • 2021-01-23
    23 min

    FC2PPV 1656957 Limited [Individual] Second delinquency … The raw vagina is polluted by two stranger sticks and collapses.

  • amateur uncensoredfc2
    • 2021-01-29
    263 min

    [BAZX-271]Creampie For Creative Female College Girls Aiming To Be Artists

  • censoredcreampiebeautiful girlBAZXbazookatetBAZX-271BAZX271h-1496bazx00271
    • 2021-02-03
    120 min

    [GVH-186]Boob Lover Shota-kun's Lewd Prank - Mio Kimishima/Honoka Tsujii

  • kimishima mio tsujii honoka censoredbig titsGVHglory questtorindoru tanakaGVH-186GVH18613gvh00186
    • 2021-02-27
    191 min

    [HONB-209]Quickie With A Beautiful Gal With Big Tits BEST

  • censoredbig titsamateurHONBmercuryfirstHONB-209HONB209h-1133honb00209
    • 2021-03-04
    74 min

    [KBTV-069]Theory: Girls Who Wait Around At Meeting Spots Reading Books Actually Love Kinky Sex

  • censoredamateurblowjobKBTVmessy tvKBTV-069KBTV069h-1514kbtv00069
    • 2021-03-09
    62 min

    345SIMM-619 A busty wife who is chased by child-rearing exposes a nasty figure that her husband does not even know!

  • amateur censoredcreampiebig titssimmsimm-619simm619345simm-619
    • 2021-03-11
    240 min

    [SUN-008]Golden Shower Exhibitionist Let's Mark Our Territory On A Peeing Date

  • censoredbig titsbeautiful girlSUNsunbacon tanakaSUN-008SUN0081sun00008
    • 2021-03-13
    119 min

    [MEYD-661]The Truth Is, I've Been Continuously Fucked By My Husband's Boss ... Kanon Amane

  • natural kanon censoredcreampiesingle workMEYDtameike gorodai omuraMEYD-661MEYD661meyd00661
    • 2021-03-19
    114 min

    [MGMQ-068]Our Slutty Teacher Loves To Break In Submissive Guys' Anal Holes With Her Strap-On! Momo Hazuki

  • hazuki peach censoredanalslutMGMQmegamithe beautiful goddess queenMGMQ-068MGMQ068mgmq00068
    • 2021-03-26
    120 min

    [MIAA-412]"I Can't Let You Go Home Today, Boss..." Reverse Cheating With A Part-Time Employee - The Two Of You Secretly Alone Together After Hours Where Your Wife Won't Find Out. Drilling Her Down To The Womb Until She Cums For Your C

  • tsukino luna censoredcreampieslutMIAAmoody shirose takaseeveryone s kikatanMIAA-412MIAA412miaa00412
    • 2021-03-29
    53 min

    [490FAND2-2]れん 2

  • amateur censoredamateurbeautiful girlfand2fand2-2fand22490fand2-2
    • 2021-03-30
    138 min

    [SDAB-174]You Worked So Hard Today. Come Home And Let Stepdaddy Spoil You. Nana Hayami

  • don t be quick censoredschoolgirlsingle workSDABsod createsuisei akaione s youthSDAB-174SDAB1741sdab00174
    • 2021-04-03
    102 min

    300MAAN-637 [Danger MAX! Super unequaled beautiful girl who loses two Ji ○ port] Transparent white skin! Pretty ass! Beautiful breasts of just the right size! The guy who comes out super is coming! I like toys like no other! Directly hit the rotor &a

  • amateur censoredcreampiesquirtingmaanmaan-637maan637300maan-637
    • 2021-04-06
    128 min

    [KTRA-287]Kind Step Sister With Beautiful Tits Showed Me How To Have Creampie Sex Ameri Hoshi

  • star ameri censoredcreampieschoolgirlKTRAk tribeKTRA-287KTRA287h-094ktra00287
    • 2021-04-09
    120 min

    [MEYD-664]Goro Tameiki 15-Year Anniversary Collaboration Part 3 - I Went To A Massage Parlor Where They Weren't Allowed To Put Out And Discovered The Uppity Married Woman Next Door Working There, So I Made Her Take My Creampie! After That She Bec

  • akari tsumugi censoredcreampiesingle workMEYDtameike gorohirokoji osakiMEYD-664MEYD664meyd00664
    • 2021-04-09
    168 min

    [IPX-636]"If You Missed The Last Train, Come Stay At My Place？" I've Got A Girlfriend, But Since I Couldn't Get Home I Stayed The Night A Female Coworker's... She Didn't Wear Panties Or A Bra And I Got So Horny I Couldn'

  • iyo fujii censoredblowjobbeautiful girlIPXidea pocketkahori maedanodishIPX-636IPX636ipx00636
    • 2021-04-10
    60 min

    H0930 ki210411 Junko Tsukahara 37years old

  • amateur uncensoredh0930
    • 2021-04-30
    106 min

    483SGK-024 [9 head and body half GAL] [Worldwide god style] [Endless continuous climax] [Kitsuman Saddle tide] [Continuous 3P overwhelming 4 shots] [No longer advance to the world! ？？ ] Gal Suta Gram Global Expansion Worldwide Half-Beauty Lunch Ki Cu

  • amateur censoredbig titssquirtingsgksgk-024sgk024483sgk-024
    • 2021-05-15
    115 min

    [MRSS-112]A Cuckolding Babymaking Vacation I Went With My Wife On A Vacation So That We Could Try To Make Babies While She Was Ovulating, But Then This Male College S*****t Creampie Fucked Her Instead Amu Hanamiya

  • hanamiya amu censoredcreampiebig titsMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-112MRSS112mrss00112
    • 2021-05-18
    64 min

    299EWDX-358 Prefer other sticks before lunch! A mature wife with plenty of luster!

  • amateur censoredmarried womansquirtingewdxewdx-358ewdx358299ewdx-358
    • 2021-05-24
    50 min

    328HMDN-365 Orgasm is good for beauty! A 23-year-old married woman who was enthusiastic about Instagram and came to an adult toy test … Reason collapsed in front of a big cock "It reaches the back!"

  • amateur censoredcreampiemarried womanhmdnhmdn-365hmdn365328hmdn-365
    • 2021-05-26
    241 min

    [C-2641]I Took This Married Woman Acquaintance Of Mine On A Hot Spring Resort Vacation & I Went On A Secret Hot Spring Resort Vacation With Another Man THE BEST HITS COLLECTION + 30 Minutes Of Previously Unreleased Special Footage

  • amateur censoredmarried womanCgogosC-2641C2641
    • 2021-05-29
    124 min

    [EMBZ-227](Viewer Discretion Advised) Rough G*******g Footage - Uncut, Unedited - Merciless Fucks Caught On Film! Swooning, Aphrodisiac-Addled, And Drilled Right Down To The Womb - Rich Wife In Glasses Ravished Until She Screams With Pleasure! Yumina

  • yumina hirosaki censoredcreampiemature womanEMBZjukujojuku emmanuellejukujo jukuEMBZ-227EMBZ227embz00227
    • 2021-06-15
    54 min

    491TKWA-005 Minami 2

  • amateur censoredcreampieamateurtkwatkwa-005tkwa005491tkwa-005
    • 2021-06-16
    120 min

    [BLK-501]Our Holes Are Wide Open For Business! Busty Sluts' Creampie Side-Gige! Three-Some POV Harem! Rika Aimi Rian Isaki

  • rumi tadami rian isagi censoredcreampiebig titsBLKkira kirakira kira black galBLK-501BLK501blk00501
    • 2021-06-19
    47 min

    H0930 ori1604 Yui Higa 30years old

  • amateur uncensoredh0930
    • 2021-07-11
    76 min

    FC2PPV 1915898 "Genuine" is here! !! , Genuine genuine! , It is inevitable to delete it immediately if it gets caught. First and last "Complete first shooting", "First vaginal cum shot" "Personal shooting" Individua

  • amateur uncensoredfc2
    • 2021-07-30
    61 min

    Caribbeancom 073021-001 Licking Woman: Nasty Beauty Slut Sucking Cock With A Smooth Face Miyuki Sakura

  • miyuki sakura uncensoredcreampiehandjobcaribbeancom
    • 2021-08-14
    51 min

    404DBL-0083 Rainy Day Mature Woman 3P! Shoko 47 Years Old & Akemi 52 Years Old

  • amateur censoredcreampiebig titsdbldbl-0083dbl0083404dbl-0083
    • 2021-09-10
    118 min

    [SSIS-167]She Went On A Business Trip With Her Boss, Whom She Absolutely Hated, And Found, To Her Surprise, That She Was Booked Into The Same Room With Him At The Inn ... This Beautiful Tits Office Lady Was Kept Cumming All Night With His Excessively

  • minami kojima censoredsingle workdramaSSISs1 no 1 stylemaeda bungouSSIS-167SSIS167ssis00167
    • 2021-09-18
    111 min

    [DDHZ-012]My Wife Is A Witch Of Nipple Play. My Wife Became A Popular Nipple Teasing Fudol And I Didn"t Even Know It. Kanna Hirai

  • shiori hirai censoredslutsingle workDDHZdogmano maru kimore no hitodzumaDDHZ-012DDHZ012ddhz00012
    • 2021-09-23
    205 min

    [CHN-209]新・絶対的美少女、お貸しします。 108 乃木絢愛(AV女優)21歳。【MGSだけのおまけ映像付き 15分】

  • amateur censoredsquirtingamateurchnchn-209chn209chn-209
    • 2021-10-08
    154 min

    [IPX-747]Coercion From An Intense Older Guy That Makes Me Take His Dirty Dick Every Single Day. Late-night Nurse Call That Signals To A Sexual Service. Nanami Misaki

  • nanami misaki censoredcreampieblowjobIPXidea pocketmaeda bungoutissueIPX-747IPX747ipx00747
    • 2021-10-11
    84 min

    259LUXU-1446 Luxury TV 1468 "If I Could Express The Eros I Have …" A Married Woman Who Works As A Curator At A Museum Takes The Plunge And Appears On Av Because Of Her Husband’S Affair! The Body Temperature Of A Man Who Feels For Th

  • amateur censoredbig titsmarried womanluxuluxu-1446luxu1446259luxu-1446
    • 2021-10-14
    483 min

    [MGHT-297]Cuckolding Gorgeous Young Wife With Colossal Tits. 16 Performers. Slutty Wife Takes Another Guy"s Dick For Non-stop Fucking. 8 Hours, 2 Volumes.

  • censoredbig titsmarried womanMGHTtakara videotakaraMGHT-297MGHT29718mght00297
    • 2021-10-15
    110 min

    FC2PPV 2345887 [Price Until Tomorrow] Dero Video When A Beautiful AV Actress With Too Strong Libido Was Always Vaginal Cum Shot In Saffle / Part 1 [Unreleased / Uncensored]

  • amateur uncensoredfc2
    • 2021-10-23
    153 min

    [CEMD-072]Fucking, Confusion! Lover Hot Devil"s Fuck Trip! Nanao Nakano -Woman Fucks Confidently With One Hand On Her D***k!

  • nanao nakano censoredmature womansingle workCEMDserebu no tomoCEMD-072CEMD072cemd00072
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-10-29
    115 min

    [MIDE-992]Five Days Living Together With Plain But Truly Carnivorous C***dhood Friend! Hana Kotone

  • kotoneka censoreduniformslutMIDEmoodyzmoodyz divaMIDE-992MIDE992mide00992
    • 2021-10-30
    240 min

    [MLSM-056]The Beautiful Mature Woman Best Series. Yu Amaki. 4 Hours. A Madonna With a Beautiful Ass, Beautiful Legs.

  • yu amagi censoredcreampiemarried womanMLSMmellow moonMLSM-056MLSM056mlsm00056
    • 2021-10-30
    50 min

    C0930 ki211031 Yukie Toyoda 42years old

  • amateur uncensoredc0930
    • 2021-11-16
    503 min

    [KTRA-351]Plain Girl With Glasses And Big Tits 4 People 500 Minutes 4-Disc Set BOX

  • hoshimi asuka fumaru tomaru censoredcreampiebig titsKTRAk tribeKTRA-351KTRA351h-094ktra00351
    • 2021-12-04
    160 min

    [LULU-107]My Big Tits C***dhood Friend Started Working At A Reverse Bunny Club, So When I Agreed To Help Her Practice Her Work Techniques, She Gave My Prematurely Ejaculating C*ck So Much Nookie, Every Day, That My Balls Went Bone Dry. Misono Mizuhar

  • suwon miso censoredcreampiebig titsLULUlunaticsvagmanLULU-107LULU107lulu00107
    • 2021-12-09
    135 min

    [STARS-474]【究極の絶頂】性欲強すぎお姉さんの本気スケベ200 ノンストップ限界突破SEX 吉永このみ

  • yoshinaga konomi censoredsoloworkSTARSsod createhajime yarigasakiSTARS-474STARS474



    • Jav Cherry, watch JAV streaming online japanese xxx