creampie def censored small tits amateur




FC2EBODHNDJUFEVENXCAWDJULMIDENATRMEYDDASDMILKSSISMIDVAWDATIDROYDAVSAAUKGKBISQTE

2020-12-26
120 min

[ITSR-087]This Married Woman Is Serious. When My Colleague Missed Her Last Train Home, I Decided To Let Her Stay The Night At My Place... And We Were Just Going To Sleep Side By Side, But Now The Mood Has Suddenly Turned Sexual!？ She's A Married

  • censoredcreampieamateurITSRbig morkalmaxitadakiITSR-087ITSR08757itsr00087
    • 2021-01-08
    135 min

    [HODV-21538]All Alone With The Ex-Boyfriend I'll Never Forget - 48 Hours Of Love-Making Mami Nagase

  • asami nagase censoredcreampiebig titsHODVh m pk c takedaHODV-21538HODV215385642hodv21538
    • 2021-01-16
    120 min

    [TPPN-182]Extreme Orgasms - Delicate Bodies Fucked Hard For Intense Climaxes. Natsu Tojo

  • natsu tojo censoredblowjobbeautiful girlTPPNteppanTPPN-182TPPN182tppn00182
    • 2021-02-01
    59 min

    FC2PPV 1667863 Limited 1980 [Uncensored] Continuous vaginal cum shot to a petite G cup chiropractor

  • amateur uncensoredfc2
    • 2021-02-10
    38 min

    FC2PPV 1680826 [Personal shooting] 18-year-old neat and clean beautiful girl ⑥. After all uniform & black stockings are the strongest ♡ It’s about time … Raw squirrel seeding, vaginal cum shot

  • amateur uncensoredfc2
    • 2021-02-12
    129 min

    [ABW-056]Creampie: Fuck As Much As You Want 8 - Ako Shiraishi

  • akiko shiraishi censoredcreampiesingle workABWprestigeitoman akifumiabsolutely wonderfulABW-056ABW056118abw00056
    • 2021-02-16
    131 min

    FC2PPV 1688712 Immediate purchase is advantageous ★ Genuine J 〇 Geki Kawarori big breasts ★ Honpo first public release ★ All the techniques to persuade from encounters are released at once ★ A total of 150 minutes or more blockbuster ★ Raw Saddle lim

  • amateur uncensoredfc2
    • 2021-03-05
    29 min

    FC2PPV 1658698 [First time limited 1980pt → 1200] GoPro video full of immersive feeling ❤️ Trajectory to M woman ❤️ Fainting convulsions with a thick vibe after insulting an active beautiful girl JD who is too beautiful with a ball gag ❤️ Superb blow

  • amateur uncensoredfc2
    • 2021-03-05
    80 min

    [LVID-016]Filthy Part Time Job ~ I Didn't Know I'd Have To Do This... ~ Reiko Fukushima

  • fukushima reiko censoredsoloworkLVIDorustak softloveidolLVID-016LVID016
    • 2021-03-10
    96 min

    435MFC-087 Slender small breasts girl who works for cheating SEX [Shiroto Gonzo ＃ Miumi ＃ 24 years old ＃ B cup (flight attendant)]

  • amateur censoredcreampiesquirtingmfcmfc-087mfc087435mfc-087
    • 2021-03-13
    91 min

    390JAC-082 [Superb Venus BODY x Special G Cup x Raw Saddle 3 Barrage] Adult children are also innocent world in see-saw games of erotic and gal! The finest G milk style! Endless Saddle Tide! Tomorrow never knows to the other side of the climax with a

  • amateur censoredcreampiebig titsjacjac-082jac082390jac-082
    • 2021-03-13
    150 min

    [IPX-629]A Lingerie Slut Rejuvenating Massage Parlor, Where You'll Be Gently Teased With Polite Dirty Talk You Won't Be Allowed To Leave Until You Ejaculate Kana Momonogi

  • kana momonogi censoredbig titssingle workIPXidea pocketinaballdishIPX-629IPX629ipx00629
    • 2021-03-13
    120 min

    [MUDR-141]College Intern Hit On By Her Boss On An Overnight Business Trip - Face-Licking, Dripping With Erotic Fluids, Creampie Cheating Sakura Tsukino

  • tsukino sakura censoredcreampiesingle workMUDRmukuMUDR-141MUDR141mudr00141
    • 2021-03-18
    154 min

    [DVDMS-646]"You Get Hard When Somebody Touches Your Nipples... Are You A Perv？" The Married Woman Next Door Teases The Nipples Of A Guy Who Happens To Be A Total Sub - This MILF Slut Loves Every Minute Of Milking His Dick, Edging Out Every La

  • censoredbig titsamateurDVDMSdeep sswing nagaseDVDMS-646DVDMS646dvdms00646
    • 2021-03-21
    166 min

    [DASD-836]Only One Person At A Time Please High-Class Double Decker Health Club Action Renka Yamamoto Nana Asakura

  • yamamoto renka censoredbig titsDASDdashajime yanaiDASD-836DASD836dasd00836
    • 2021-04-23
    149 min

    [JUFE-286]新婚の僕が出張先で女上司とまさかの相部屋 朝から晩まで性奴●にされた逆NTR 篠田ゆう

  • shinoda yu censoredcreampiebig titsJUFEfitchJUFE-286JUFE286jufe00286
    • 2021-04-28
    79 min

    259LUXU-1375 Luxury TV 1397 Slender busty half-faced idols make their long-awaited AV first appearance. Dense sex that gets drunk with the technique of an actor while shaking the soft big tits that captivate men in the world!

  • amateur censoredbig titsamateurluxuluxu-1375luxu1375259luxu-1375
    • 2021-05-01
    119 min

    [ADN-316]Days Spent Fucking My Girlfriend's Sister Raw Kana Kusakabe

  • kana kusakabe censoredbig titssingle workADNattackerskitorune kawaguchiotona no dramaADN-316ADN316adn00316
    • 2021-05-01
    120 min

    [SSIS-051]Giving A Woman With An Amazing Ripe Body Aphrodisiacs And Having Enhanced Sex Full Of Orgasms And Incontinence Saki Okuda

  • saki okuda censoredbig titsmature womanSSISs1 no 1 stylemon cSSIS-051SSIS051ssis00051
    • 2021-05-06
    98 min

    [HONE-260]Soft Pressure And Squishy Squeezing! Groping My Step Mom's Titties Mako Oda

  • oda mako censoredcreampiebig titsHONEcenter villagesouthern earthhanazono center villageHONE-260HONE260h-086hone00260
    • 2021-05-13
    60 min

    Pacopacomama 051321_476 The senior helper who has big boobs Kaho Kitayama

  • amateur uncensoredpacopacomama
    • 2021-05-28
    118 min

    [MIDE-934]I Got Fucked ... This Beautiful Office Lady Came To Me, Seeking Help, And She Was Dripping Wet And Not Wearing A Bra, And I Could No Longer Resist, So I Fucked Her Brains Out. Mizuki Aiga

  • mizuki ai censoredcreampiesingle workMIDEmoodyzlamb chopmoodyz divaMIDE-934MIDE934mide00934
    • 2021-06-01
    242 min

    [AMBS-067]Ready To Eat Barely Legal Shaved Pussies BEST 15

  • abe mikako ichinose momo censoredbeautiful girlAMBSplanet plusambibarentzAMBS-067AMBS067h-237ambs00067
    • 2021-06-12
    202 min

    [BAZX-293](All POV) Nailing My Hot Receptionist vol. 003

  • censoredcreampieuniformBAZXbazookatodoBAZX-293BAZX293bazx00293
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-29
    44 min

    274DBL-0101 It may be JD in the middle of intercrural sex ~ Insert raw raw Hiyori 21 years old

  • amateur censoredamateurbeautiful girldbldbl-0101dbl0101274dbl-0101
    • 2021-07-15
    74 min

    200GANA-2520 Seriously Nampa, First Shot. 1662 Interview With A Sleeveless Older Sister With Beautiful Legs, "where Are You Having An Affair？" Naturally, The Investigation Goes In The Erotic Direction … The Voice Of A Beautiful Woman Of

  • amateur censoredamateurganagana-2520gana2520200gana-2520
    • 2021-07-22
    483 min

    [FCDSS-011]A Horny Big Tits Elder Sister Full Course Service Slut Plays Yuko Ono Best Hits Collection 8 Hours

  • yuko ono censoredbig titsslutFCDSSfalenofaleno starFCDSS-011FCDSS0111fcdss00011
    • 2021-07-23
    62 min

    10musume 072321_01 Sex with a friend who gently cares for me who has an injured hand Mina Nomoto

  • amateur uncensored10musume
    • 2021-08-13
    123 min

    [FOCS-016]I Met This 142cm Girl Overseas. Recruiting An Innocent Angel First Video! South East Asia Sex Trip Rara Kudo

  • lara kudo censoredblowjobbeautiful girlFOCSabc mousou zokufocusFOCS-016FOCS016focs00016
    • 2021-08-13
    173 min

    [SKMJ-194]I"m Going On A Harlem Hot Spring Resort Vacation With 6 College Girl Babes, And I"m The Only Guy! After A Seven-Way Large Orgies Fuck Fest In The Outdoor Bath And Cumming Like Crazy, These Horny JDs Were Still Not Satisfied, And The

  • censoredbig titsbeautiful girlSKMJsekimenjoshinagase swingsekimen goshiSKMJ-194SKMJ194h-1324skmj00194
    • 2021-08-21
    242 min

    [NASH-557]Beautiful Tits! A Beautiful Ass! A Small Waist! A Beautiful Mature Woman With A Bewitching Body That Meets All Three Important Conditions

  • asagiri hikari maki kyoko censoredcreampiebig titsNASHnadeshikonagasawa junNASH-557NASH557nash00557
    • 2021-08-29
    49 min

    229SCUTE-1125 Marina (24) S-Cute Squirting Love Black Hair Uniform Girl Sex

  • amateur censoredsquirtinguniformscutescute-1125scute1125229scute-1125
    • 2021-09-01
    125 min

    [NACR-452]The Beautiful Married Woman Next Door Got So Wasted She Came Into The Wrong Apartment, "I"m Hoooommme!" Miki Sunohara

  • future sunohara censoredbig titsmature womanNACRplanet plusdirector oshichi ku ryuuNACR-452NACR452h-237nacr00452
    • 2021-09-24
    125 min

    [HMN-040]A Fresh Face I"m 20 Now ... So I Don"t Want To Be A Virgin Anymore!! I Have No Experience With Men, But I Have So Much Knowledge About Sex, It"s Time I Made My Creampie Adult Video Debut Kotori Chino

  • kotori chino censoredcreampiebig titsHMNhonnakaarashiyama michiruHMN-040HMN040hmn00040
    • 2021-10-01
    220 min

    [WAAA-100]Tsubomi"s First Ever Kabukicho Experience: A Sex Industry Nightlife Report With Tons Of Fucking And Cumming

  • bud censoredcreampieblowjobWAAAwanz factoryWAAA-100WAAA100waaa00100
    • 2021-10-09
    117 min

    [MDTM-743]A New After-School Special of Rejuvenating Reflexology from a Slut and Beautiful Girl, Nanami Yokomiya

  • yokomiya nanami censoredcreampieuniformMDTMk m producetodouchuu kikakuMDTM-743MDTM743mdtm00743
    • 2021-11-07
    80 min

    FC2PPV 2409469 [Limited Price Until Today] Kyou-Chan Is The Most Sexually Lustful, Super-Sensitive, Too Erotic And So Cute, Anyway, The Day When Two People Got Fucked For A Whole Day / First Raw Vaginal Cum Shot & First Anal Sequel Correction] * W

  • amateur uncensoredfc2
    • 2021-11-11
    160 min

    [MIST-355]Tokyo Nipple Girl Yurika Aoi Who Controls Ejaculation, Squirting, Female Ecstasy, And Pleasure By Skilled Nipple Play.

  • yurika censoredsquirtingmature womanMISTmr michirurassha miyoshiMIST-355MIST3551mist00355
    • 2021-11-19
    160 min

    [SSIS-253]He Always Dreamed About Getting Jammed By Colossal Tits Like These ... The Man Could Not Resist A Titty Fuck Like This. This Titty Slut Could Melt His C*ck Like Butter In Her Hands Konan Koyoi

  • koyoi konan censoredbig titsblowjobSSISs1 no 1 stylegoemonSSIS-253SSIS253ssis00253
    • 2021-11-25
    49 min

    H0930 ki211125 Takako Kuronuma 38years old

  • amateur uncensoredh0930
    • 2021-12-02
    109 min

    [MILK-128]I Told This G-Cup Newlywed Lady Who Was About To Have Her Wedding That I Was Going To Give Her Some Special Treatment, And Instead Developed Her Sensual Abilities This Sensitive Big Tits Wife Was Lathered Up With Oil And Started To Feel Sup

  • future sena censoredcreampiebig titsMILKmilkMILK-128MILK128h-1240milk00128
    • 2021-12-04
    134 min

    [GVH-323]The Sexy PA, Chairman, Distressed Female Teacher and Bad Boy S*****t Yuri Tadokoro/Ema Asahi

  • yuri tadokoro chaoyang ema censoredGVHglory questhyonGVH-323GVH323gvh00323
    • 2021-12-23
    124 min

    [DLDSS-041]I Was Corrupted By A Vile Scumbag Boss / It Was An Abominable Night That I Couldn"t Tell My Husband Even If I Died... Rin Azuma

  • dongguan censoredcreampiedeepthroatDLDSSdahliasho saigoDLDSS-041DLDSS0411dldss00041
    • 2021-12-27
    196 min

    [MDVHJ-044]An Unfaithful Married Woman Is Captivated By Her Big Dick Brother-in-law"s Intense Hips.

  • natsuko haraguchi yuri mizukawa censoredbig titsmature womanMDVHJgraffiti japanmovieMDVHJ-044MDVHJ04448mdvhj00044
    • 2022-01-03
    71 min

    230OREC-982 Arisa

  • amateur censoredamateurbeautiful girlorecorec-982orec982230orec-982
    • 2022-02-05
    151 min

    [MDBK-222]Miniskirt Thong S********l 4

  • satoshi kuruki ichika matsumoto censoredcreampieschoolgirlMDBKbazookak taroMDBK-222MDBK222mdbk00222
    • 2022-02-17
    53 min

    [494SIKA-174]可愛いGカップ巨乳娘2人と神乱交！

  • amateur censoredbig titsamateursikasika-174sika174494sika-174
    • 2022-02-19
    136 min

    [SCPX-444]I Was Alone With My Friend"s Mother She Must Be Showing Off Her Cleavage And Sexy Ass To Me On Purpose So That I Can Sneak Peeks And I"m Absolutely Certain That She"s Luring Me On! "Your Mama Is A Super Hot Babe!!" The T

  • censoredcreampiemomSCPXscoopmousouzokuSCPX-444SCPX444scpx00444
    • 2022-03-03
    102 min

    [AARM-065]Older Step-sister Guides A Dick Between Her Panties To Work Out A Cum Load, Now Her Panties Are Covered In My Cum For Even More Panty Shot Temptation!

  • miko shion naoko yokoyama censoredAARMaroma planninghamu oujiaromaAARM-065AARM065aarm00065
    • 2022-03-12
    169 min

    [SORA-371]Naughty Married Sub & Exhibitionist

  • censoredbig titsmarried womanSORAmountain and sky delusion grouphimrockmountains and skySORA-371SORA371sora00371
    • 2022-03-11
    480 min

    [MIZD-271]Sensitive Cock Kneading Right After Ejaculating! Cleaning BLowjobs 100 Shots Over BEST

  • nanasawa mia shoko takahashi censoredblowjobbeautiful girlMIZDmoody smoodyz bestMIZD-271MIZD271mizd00271
    • 2022-03-18
    160 min

    [JUL-902]Madonna Proudly Presents Two Exclusive And Popular Slender Actresses In A Gorgeous Co-Starring Harem Escapade!! "Can We Spend The Night At Your Place？ You Understand That This Is An Order, Right？" After Missing Their Last Train Home,

  • kana mito anzu komatsu censoredcreampiemarried womanJULmadonnananzaki masakiJUL-902JUL902jul00902
    • 2022-03-31
    22 min

    FC2PPV 2765750 * Ends Tomorrow * Prefectural General Course ② Gonzo With Beautiful Legs Band Girl And Plain Clothes

  • amateur uncensoredfc2
    • 2022-04-08
    120 min

    DASD-990 If She"s Asked, She Can"t Refuse! U*********s Temptation From A Gentle, Natural Married Beauty. Sumire Mizukawa

  • mizukawa violet censoredcreampiesingle workDASDdasrokusaburo mishimaDASD-990DASD990dasd00990
    • 2022-04-08
    120 min

    VEO-058 Real Amateur Housewife AV Debut!! Huge G Cup Tits On Wife With An Athletic Body Who Cannot Hide Them When They Pop Out. Rika Momozono.

  • momozono rika censoredcreampiesingle workVEOvenuskaniebornVEO-058VEO058veo00058



    • Jav Cherry, watch JAV streaming online japanese xxx