creampie censored housewife high vision big tits




FC2AWDKSBJBBANKBIAUKGDASDCHRVGMEMFSDSSGVHAVSAWAAAMIAAMEYDROYDMILKSQTEAPODVENUADN

2020-11-20
48 min

[oretd-801]HIMARI 2

  • amateur censoredcreampieuniformoretdoretd-801oretd801oretd-801
    • 2020-11-28
    123 min

    [MIAA-358]While My Parents Were Suddenly Away... I Was Left With My C***dhood Friend, And We Didn't Have Any Money For Condoms, So We Spent Our Days Creampie Fucking Like Crazy Rei Kuruki

  • satoshi kuruki censoredcreampiesquirtingMIAAmoodyzjo asagirieveryone s porn starMIAA-358MIAA358miaa00358
    • 2020-11-29
    212 min

    [KTKC-101]These Prim And Proper Amateur Girls Have Big Tits And Sexy Bodies Deluxe 213-Minute Edition

  • censoredcreampiebig titsKTKCkitixx mousouzokubig titsKTKC-101KTKC101ktkc00101
    • 2020-11-29
    82 min

    [HOKS-087]Modern Flesh Fantasy Theater A Father-In-Law And Daughter-In-Law To Fuck And Get Fucked

  • yuki kanno miho tomii censoreddramaHOKSfa prokinzo ogurokkuHOKS-087HOKS087hoks00087
    • 2020-12-03
    61 min

    [per-345]かれん

  • amateur censoredamateurperper-345per345per-345
    • 2020-12-07

    FC2PPV 1597903 Limited to 2 days [Uncensored] Continuous vaginal cum shot on a slender brown-haired gal-drinking in a private room (50 minutes)

  • amateur uncensoredfc2
    • 2020-12-24
    43 min

    H4610 ki201224 Kaoru Naito 18years old

  • amateur uncensoredh4610
    • 2020-12-27
    120 min

    [FONE-129]The Horniest Girl With Big Tits This Charismatic Pick Up Artist Has Ever Scored In His Whole Life: Riko - This Natural Born Sub Is Caught On Camera Begging For More

  • censoredcreampiebig titsFONEfirst starplus first starFONE-129FONE129h-491fone00129
    • 2021-01-01
    269 min

    [VPC-005](Aphrodisiac-Powered Sex With You, A Special Edition) Super Erotic Amateur Private Videos Are Being Leaked For Your Viewing Pleasure 05

  • censoredcreampiebig titsVPCprestigevideo podcastVPC-005VPC005118vpc00005
    • 2021-01-09
    40 min

    [fc2-ppv 1637709]【数量限定】瀧◯梨絵② （長尺ver）

  • amateur uncensoredfc2
    • 2021-01-11
    12 min

    10musume 011121_02 I Want It Deep Inside Me Yui Asakawa

  • amateur uncensored10musume
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-24
    126 min

    [KIMU-015]Breaking In My Naughty Stepdaughter Ichika Matsumoto

  • ichika matsumoto censoredcreampiebeautiful girlKIMUavs collector shiroyukifresh babe avs collector sKIMU-015KIMU015kimu00015
    • 2021-01-29
    120 min

    [NEM-053]New: Abnormal Sex - Stepmom In Her Forties & Stepson - 13 - Horny Moms Giving In To The Temptation Of Young Cock Mari Kuroki

  • kuroki mari censoredcreampiebig titsNEMglobal media entertainmentyayoi nakanonewmomNEM-053NEM053143nem00053
    • 2021-02-06
    56 min

    H0930 ki210207 Misa Oohara 45years old

  • amateur uncensoredh0930
    • 2021-02-06
    45 min

    FC2PPV 1675416 * Uncensored * Young wife Hazuki ☆ Forcibly raw SEX during the interview ♡ I’m crazy with a sense of immorality! !! !!

  • amateur uncensoredfc2
    • 2021-02-13
    76 min

    200GANA-2435 Seriously Nampa, first shot. 1597 Succeeded in picking up a female college student with a plump body who is worried about big ass! Take me to the hotel to help with body makeup and start touching on the training equipment ♪ Good quality

  • amateur censoredbig titsamateurganagana-2435gana2435200gana-2435
    • 2021-03-12
    39 min

    [tyvm-140]ひなみ(36)

  • amateur censoredcreampiebig titstyvmtyvm-140tyvm140tyvm-140
    • 2021-03-17
    37 min

    492MERC-289 Chemical Party Video

  • amateur censoredcreampieamateurmercmerc-289merc289492merc-289
    • 2021-03-19
    63 min

    FC2PPV 1694498 [Limited quantity 2980pt → 1980pt] Legendary Pukuman ❤️ Active cosmetic surgery esthetician Kaho who was deceived by massage recruitment ❤️ Plump and thick Oma ○ This is a permanent preservation version Many purchase benefits

  • amateur uncensoredfc2
    • 2021-03-27
    120 min

    [KSBJ-128]My Step Mom Loves Playing WIth Me Matsuri Kanan

  • nichinan festival censoredcreampieblowjobKSBJksb kikaku emmanuellebito sakuraKSBJ-128KSBJ128ksbj00128
    • 2021-03-27
    146 min

    [XVSR-585]The Masked Couple ~ Women Who Fuck And Women Who Get Fucked ~ Complete Version Azusa Misaki Nozomi Arimura

  • misaki azusa arimura nozomi censoredcreampiedramaXVSRmax ak c takedacalenXVSR-585XVSR585xvsr00585
    • 2021-04-06
    132 min

    [KIRE-033]Climaxing 52 Times! 3 Cum Shots! Ripe H-Cup Body Shakes And Convulses To The Limit! Female CEO Is Fucked And Has Her Titties Groped By A Younger Man Yumi Narusaki 46 Years Old

  • grace narisaki censoredbig titsmature womanKIREsod createyosukebeauty kirei sodKIRE-033KIRE0331kire00033
    • 2021-04-07
    120 min

    [MSA-011](Amateur Videos) (Creampie Raw Footage) 11 Tomoka (21 Years Old) Is A Shaved Pussy Babe She's Using Her Pussy's Sensors To Search Out Cocks And Spreading Her Legs For Some Big Time Fucking! She Kept On Screaming, "This Feels So F

  • amateur censoredcreampieuniformMSAfuturefuture futureMSA-011MSA011
    • 2021-05-02
    243 min

    [MMB-362]10 Sensitive Y********ls Open Their Legs Without Thinking After Getting Turned On By An Oil Massage

  • censoredMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-362MMB362mmb00362
    • 2021-05-14
    239 min

    [HUNTB-018]"Get Over Here! Keep The Clothes On, Just Get In!" You And A Female Friend Decided To Party At Her Place, And Once She Got A Little Tipsy She Invited You Into Her Cramped, Tiny Bath With Her - Clothed!

  • censoredblowjobHUNTBhuntermorikihhh groupHUNTB-018HUNTB018huntb00018
    • 2021-05-28
    72 min

    300NTK-577 Raw chin raw insertion in the pool of the example with a beautiful girl raw distributor who is too cute! !! The pant voice of Kansai lead that leaks involuntarily with raw piss is evidence of a live reaction! ？？ Of course, the finale is fu

  • amateur censoredcreampieamateurntkntk-577ntk577300ntk-577
    • 2021-06-04
    120 min

    [JUL-598]Mom's Friends - Hoka Yonekura

  • hoika yonekura censoredmature womanslutJULmadonnajyoji kawaiJUL-598JUL598jul00598
    • 2021-06-11
    76 min

    [HYPN-044]Influenced And Dominated Stepmom: Turning My Father's New Wife Into An Obedient Sex Servant - Akane Soma

  • soma censoredcreampiemarried womanHYPNsod createsatoshi morikawamind controlHYPN-044HYPN0441hypn00044
    • 2021-06-15
    60 min

    Pacopacomama 061521_490 Married Pussy Encyclopedia, 137 Deluxe Edition Mikako Tachibana Junko Kunida Sachiko Takahashi

  • amateur uncensoredpacopacomama
    • 2021-06-15
    135 min

    [KTRA-304]Creampie For Her Secret Shaved Pussy Sara Kagami

  • kagami sara censoredcreampiesoloworkKTRAk tribeKTRA-304KTRA304
    • 2021-06-17
    69 min

    200GANA-2506 Seriously Nampa, first shot. 1649 Pretending to be a neat music college student who aspires to be a music teacher and picking up! Although I am confused by the erotic story, if I give a flickering reward, I will be swept away and open my

  • amateur censoredbig titsamateurganagana-2506gana2506200gana-2506
    • 2021-06-19
    126 min

    [JUL-621]I Was Going To Deflower My Stepdaughter's Cherry Boy Boyfriend, But ... He Turned Out To Be A Tireless Piston-Pumping Machine Who Fit Me Like A Glove And Now I Can't Live Without Him Anymore. Rin Okae

  • rin okae censoredbig titsmature womanJULmadonnarokusaburo mishimaJUL-621JUL621jul00621
    • 2021-08-07
    123 min

    [KYMI-014]High Leg Wearing Slut

  • hamazaki mao suzuki mayu censoredslutKYMImiruyumeno aidaKYMI-014KYMI014kymi00014
    • 2021-08-20
    121 min

    [UDAK-006]"Be on your guard..." I Pranked The Woman Giving Me A Massage

  • censoredcreampieuniformUDAKstar paradiseyudakimoUDAK-006UDAK006h-254udak00006
    • 2021-08-27
    20 min

    10musume 082721_01 An Amateur Girl Who Collects Semen Shot On Her Face Without A Blow Job And Tastes Every Drop Rui Minazuki

  • amateur uncensored10musume
    • 2021-09-03
    157 min

    [CAWD-279]Sexual Healing Massage Where They Smile Big And Whisper Calmly To Guide You To Many Deep Orgasms, Natsu Hinata

  • natsu hinata censoredbeautiful girlhandjobCAWDkawaiilamb chopCAWD-279CAWD279cawd00279
    • 2021-09-09
    40 min

    [IENFH-009]I Was Playing Pranks On My Big Stepsister That Night, But Then She Turned The Tables On Me And Fucked Me Raw, And I Was About To Cum, But Then She Locked Me Down With Her Legs And I Couldn"t Escape, So I Ended Up Creampie Cumming Insid

  • minami kozue censoredcreampieIENFHi energychrysanthemumienfIENFH-009IENFH0091ienfh00009
    • 2021-09-17
    58 min

    230OREC-884 Meru

  • amateur censoredcreampiebig titsorecorec-884orec884230orec-884
    • 2021-09-24
    143 min

    [CJOD-314]"Hey... Why Are You Twitching So Hard There" Expert Slut Reverse Pick Up. Sudden Male Squirting. Yu Shinoda , Hibiki Otsuki

  • shinoda yu otsuki sound censoredcreampieslutCJODbiham the mcchijo hebunCJOD-314CJOD314cjod00314
    • 2021-10-15
    153 min

    [BLK-527]Convenient Free Pussy! Fucking Raw Till Morning With A Horny Bitch Who Loves Older Men 08

  • censoredcreampiesquirtingBLKkira kirakira hosi kira black galBLK-527BLK527blk00527
    • 2021-11-05
    240 min

    [HUNBL-067]A Furious Iron-Hammer Face-Fucking for the Lesbian Sisters Who Hate Men

  • censoredcreampielesbianHUNBLhuntergeminihhh groupHUNBL-067HUNBL067hunbl00067
    • 2021-11-11
    240 min

    [DOCP-329]部屋連れ込み隠し撮りSEX そのまま勝手にAV発売 2

  • amateur censoredcreampieamateurdocpdocp-329docp329docp-329
    • 2021-11-12
    60 min

    230OREC-934 Uika (Noau Ika)

  • amateur censoredcreampieamateurorecorec-934orec934230orec-934
    • 2021-11-13
    157 min

    [SORA-345]Wife Is Addicted To Infidelity. Date In The City Ends Up With Squirting And Piss For 2 Rounds Of Cum Swallowing. Soaking Wet Pussy Twitching And Exposed As It Gets Ready To Swallow A Dick Right Up. 3 Scenes Of Fucking! 4 Cum Loads! Getting

  • yurika censoredbig titssingle workSORAyama to sorahimurokkuSORA-345SORA345sora00345
    • 2021-11-14
    112 min

    [KIZ-003]長身敏感主婦の飲精交尾 美都栞奈 32歳

  • mito shiori censoredcreampiebig titsKIZjeweljueruKIZ-003KIZ003h-848kiz00003
    • 2021-11-19
    116 min

    [SSIS-245]How A Gambling Addict Like Me Who Loves Liquor Got A Married Model-Tier Babe To Fuck Me Every Day Ichika Hoshimiya

  • ichika hoshimiya censoredsingle workSSISs1 no 1 stylenikusonSSIS-245SSIS245ssis00245
    • 2021-12-11
    67 min

    FC2PPV 2504630 [Individual Shooting] No88 Yui-Chan 18-Year-Old Ss-Class Beautiful Girl Is Intensely Pistoned By The Second Etch Of Her Life And Is In Agony With Man Juice Dripping, Tapping Into A Beautiful Girl Who Longs For Going Out, Pregnancy Is R

  • amateur uncensoredfc2
    • 2021-12-24
    122 min

    [JUL-814]On A Trip To A Hot Spring To Celebrate The End Of My Life, My Boss Keeps Making Me Cum Inside.

  • censoredcreampiemature womanJULmadonnadragon nishikawaJUL-814JUL814jul00814
    • 2021-12-29
    66 min

    FC2PPV 2551687 [Personal Shooting] God Times !! ★ 18-Year-Old Still Orthodox Beautiful Girl Gonzo Attending A Private Lady School !!

  • amateur uncensoredfc2
    • 2022-01-29
    121 min

    [BKD-277]Stepmother And Offspring Sex. [West Otawara Road] Nanao Nakano.

  • nanao nakano censoredcreampiemature womanBKDrubytsuji koujitabijiBKD-277BKD277bkd00277
    • 2022-02-11
    124 min

    [BOBL-001]Amateur New Face Debut - H-Cup Colossal Tits X Extremely Small Waist - Busty "REI" Box - Limit - Master Boob Seducer Sweet Talks Stacked Amateur Into Breast Fetish Play

  • rei censoredbig titssingle workBOBLabc mousouzokuboinbox limitBOBL-001BOBL001bobl00001
    • 2022-02-11
    40 min

    FC2PPV 2660181 [In Search Of A Married Woman] <Resident In A Rural Area> A Beautiful Wife Who Is Hungry For A Cock With A Super Lascivious Face And 3p Cum Shot Continuous Injection! I Thoroughly Enjoyed The Shit Erotic Face And Fellatio.

  • amateur uncensoredfc2
    • 2022-02-19
    129 min

    [CEMD-133]Age Difference Lesbian Sex Revealed! Alice Kisaki With Chisato Shoda . A Woman Gets To Know Her First Experiences Of Lesbian Pleasure And Enjoys Wild Non-stop Orgasms In Bed!

  • kisaki alice shota chisato censoredbig titslesbianCEMDceleb no tomoCEMD-133CEMD133cemd00133
    • 2022-02-19
    61 min

    [HEYZO-2725]Emi Sakurai MILF"s Sexual Service at the Soapland Vol.4

  • emi sakurai uncensoredcreampieheyzo
    • 2022-02-22
    66 min

    C0930 tk0052 Rikako Danno 33years old

  • amateur uncensoredc0930



    • Jav Cherry, watch JAV streaming online japanese xxx