cowgirl javcensored jav high visio creampie




FC2NATRSSISBLKAPODATIDKBISQTECJODSANFSDSSMIAADASDSSNIMVSDMIDVGMEMCHRVADNHDKASPRD

2020-09-13
41 min

FC2PPV 1500862 * First shot [with purchase privilege & review privilege] Active cabaret girl Kanon-chan 19 years old ♡ After-sales is a love hotel and vaginal cum shot rich SEX ☆ Cheeky gal who is good at pillow sales is de M-chan! part1 * Uncens

  • amateur uncensoredfc2
    • 2020-10-08
    120 min

    [FSDSS-107]Reverse NTR Deep Kiss Hot Springs Trip - Natsu Tojo

  • natsu tojo censoredbeautiful girlsingle workFSDSSfalenocamelfaleno starFSDSS-107FSDSS1071fsdss00107
    • 2020-10-09
    76 min

    [HYPN-033]A Brainwashed Sex Doll A Beautiful College Girl Is Manipulated Into Total Sex Miku Abeno

  • miku abe censoredcreampiesingle workHYPNsod createkei morikawam l coHYPN-033HYPN0331hypn00033
    • 2020-10-23
    121 min

    [SGM-044]Married Woman Whaling Ship: A Forty-something Beautiful Mature Woman, Mass Squirting Document - Mio Morishita

  • mio morishita censoredcreampiebig titsSGMglobal media entertainmentjiro sadojimasuper global mediaSGM-044SGM044143sgm00044
    • 2020-11-03
    130 min

    [SDDE-634]Rich Married Woman Tries An Energy D***k That Makes Her Hopelessly Horny - And Obedient! Yu Shinoda

  • shinoda yu censoredcreampiebig titsSDDEsod createkei morikawasenzSDDE-634SDDE6341sdde00634
    • 2020-11-13
    120 min

    [DASD-755]My Tiny, Pale-Skinned Girlfriend Hates Older Guys, But My Old Man Bred Her Anyway. Hikaru Minazuki

  • hikaru minazuki censoredcreampiebeautiful girlDASDdasrokusaburo mishimaDASD-755DASD755dasd00755
    • 2020-11-13
    58 min

    328HMDN-311 [Demon cock x married woman] The secret of a mom who never wants to be seen by her 3-year-old son Gonzo personal shooting [Amateur personal shooting] who wants to insert himself with a raw cock

  • amateur censoredcreampiemarried womanhmdnhmdn-311hmdn311328hmdn-311
    • 2020-11-19
    196 min

    [SSNI-899]Soft Sensitive Titty Special! Enjoy A Full Course Of G-Cup Boobs 200 Minutes Mahina Amane

  • amane mahina censoredbeautiful girlsingle workSSNIs1 no 1 stylegoemonSSNI-899SSNI899ssni00899
    • 2020-11-29

    FC2PPV 1588074 Limited number [No] Male experience continuous vaginal cum shot to one nursing student (47 minutes)

  • amateur uncensoredfc2
    • 2020-12-05
    119 min

    [JUL-399]Reunion At The After Party... She's Become A Married Woman Now But She Wants To Fuck As Much As Ever. Ema Asahi

  • chaoyang ema censoredcreampiebig titsJULmadonnahimu lockJUL-399JUL399jul00399
    • 2020-12-11
    77 min

    [ykmc-042]アイ(25)

  • amateur censoredcreampiebig titsykmcykmc-042ykmc042ykmc-042
    • 2020-12-12
    52 min

    C0930 ki201212 Request

  • amateur uncensoredc0930
    • 2020-12-14
    57 min

    328HMDN-320 [Athletic club college student x married woman 3P] Plump K cup big breasts wife 37 years old Married woman’s sexual curiosity, aphrodisiac with 3P with athletic club boys, full-body convulsions

  • amateur censoredcreampiebig titshmdnhmdn-320hmdn320328hmdn-320
    • 2020-12-17
    163 min

    [DVDMS-611]Mei Satsuki - Finally Ready For A Creampie 3 Fucks, 8 Loads - She's All Grown Up And Ready For The Real Thing

  • satsuki mei censoredcreampiebig titsDVDMSdeep sgreenhouse effectDVDMS-611DVDMS611dvdms00611
    • 2020-12-24
    132 min

    [IESP-672]Ready For Lesbian - My Stepsister's In Love With Me Honoka Tsujii

  • tsujii honoka yui hatano censoredbig titslesbianIESPienergykikuriniespIESP-672IESP6721iesp00672
    • 2021-01-01
    269 min

    [VPC-005](Aphrodisiac-Powered Sex With You, A Special Edition) Super Erotic Amateur Private Videos Are Being Leaked For Your Viewing Pleasure 05

  • censoredcreampiebig titsVPCprestigevideo podcastVPC-005VPC005118vpc00005
    • 2021-01-02
    125 min

    [ARM-938]Let's Decide It With A Card Game! The Masturbation Shuffle

  • chiharu miyazawa naoko akase censoredARMaroma planninghamu oujiaromaARM-938ARM938arm00938
    • 2021-01-15
    62 min

    SIRO-4392 [First shot] [Nasty x Married woman x Obscene ass] [Married woman of the president’s secretary] An elegant president’s secretary appears. A frustrated wife who has left a nasty body is given a cum many times .. AV application on t

  • amateur censoredmarried womanamateursirosiro-4392siro4392siro-4392
    • 2021-01-25
    62 min

    IDJS-036 Yuri

  • amateur censoredamateurblowjobidjsidjs-036idjs036idjs-036
    • 2021-01-29
    42 min

    490FAN-080 Hitomi

  • amateur censoredamateurfanfan-080fan080490fan-080
    • 2021-02-11
    55 min

    [gerk-348]まこ姉ちゃん

  • amateur censoredcreampieamateurgerkgerk-348gerk348gerk-348
    • 2021-02-14
    59 min

    FC2PPV 1686390 [Unprecedented 6P outflow! ] Big areola for big breasts and beautiful breasts! Bitch 3 beauty vs big cock corps creampie! Squirting! Continuous Acme Shuike Meat Forest Hyper Raw Saddle Orgy [Personal Shooting]

  • amateur uncensoredfc2
    • 2021-02-15
    30 min

    FC2PPV 1687835 [Sale for a limited time] The second G-cup beautiful breast girl Miku-chan! From the cum with the electric massage machine & without the blow job, the happening occurs at the end 〇〇! ？？

  • amateur uncensoredfc2
    • 2021-02-18
    143 min

    [ROYD-042]Only I Know That The Prim, Proper-Looking Girl In Glasses At My Work Is Really A Secret Slut With Pale Skin And Colossal Tits Rina Takase

  • rina takase censoredcreampiebig titsROYDroyalcognac kaminohhh groupROYD-042ROYD042royd00042
    • 2021-02-19
    122 min

    [HZGD-179]"Whose Pussy Feels Better - Hers Or Mine？" Nympho MILF Seduces Her Daughter's Boyfriend Kurea Hasumi

  • hasumi claire censoredcreampiebig titsHZGDmarried woman flower garden theaterhirokoji osakiimage married woman flower garden theatHZGD-179HZGD179h-1100hzgd00179
    • 2021-02-19
    114 min

    [ISD-134]Nation-Wide Jukujo Sousakutai - Overnight Trips To The Country! Chichibu, Saitama Edition - Kasumi Ikeya

  • ayumi tsubasa azusa kirihara azusa ito censoredlesbianISDrubymaterukazu umiyamaISD-134ISD13421isd00134
    • 2021-03-13
    126 min

    [CEAD-332]I'm A Horny Masturbationist And I've Gone Crazy For Pleasure 12 Himari Kinoshita

  • himari kinoshita himari hanazawa censoredmature womansingle workCEADceleb no tomoCEAD-332CEAD332cead00332
    • 2021-03-21
    117 min

    [HND-965]72 Hours With My Sister's Friend After She Made Me Be Celibate For 30 Days I Was Milked And Fucked For 17 Loads Of Cum Maron Natsuki

  • marin natsuki censoredcreampieslutHNDhon nakamametaro mamezawaHND-965HND965hnd00965
    • 2021-03-29
    63 min

    328HMDN-349 [♀ Personal Shooting] Natsuha-chan 23-year-old model-class beauty OL ☆ Cock-hungry advertising agency’s carnivorous Bali carry OL’s peach butt is pierced in the vagina with wild copulation SEX and squirrels die SEX [Amateur vide

  • amateur censoredamateurhmdnhmdn-349hmdn349328hmdn-349
    • 2021-03-30
    89 min

    491TKWA-081 A large amount of vaginal cum shot while enjoying the young and beautiful bowl-shaped F cup boobs of a female college student!

  • amateur censoredcreampiebig titstkwatkwa-081tkwa081491tkwa-081
    • 2021-03-31
    240 min

    [RVH-008]Women Getting Their Asses Fucked By Their Step Family All Over The House BEST vol. 1

  • nishida karina reiko kitagawa censoredmarried womandramaRVHglory questRVH-008RVH00813rvh00008
    • 2021-04-13
    137 min

    1Pondo 041321_001 Mitsuha Kikukawa : Mitsuha Kikukawa Special Edition

  • amateur uncensored1pondo
    • 2021-04-15
    155 min

    [MMYM-044]Y********l With Huge Tits Started Out Cutely Seducing Me But Gets Carried Away And Is Soon Screaming, Shaking, And Talking Dirty Mao Hamasaki

  • hamazaki mao censoredslutsingle workMMYMmarrionaida yumenoyumenoMMYM-044MMYM044mmym00044
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    115 min

    [RBK-012]The Tragic Super High-Class Raw Sex Soapland Lady Michiru Kyujo

  • kujo michiru censoredsingle workRBKattackerseitaro hagaeryupakuRBK-012RBK012rbk00012
    • 2021-05-02
    149 min

    [DNJR-050]She Wants To Domme And I Want To Be Dominated. I Was Suddenly Transferred To My Company's Lingerie Division And Seeing Me So Flustered Awakened My Coworker's BDSM Instincts - She Started Hitting On Me At Work Under The Guise Of &quo

  • inaba chiaki uehara censoredbig titsslutDNJRdog daydreamersmaboroshikoDNJR-050DNJR050dnjr00050
    • 2021-05-05
    115 min

    [LOL-194]Blowjob Specialist: Recorded Video Of A Devilish Step-uncle Who Fucks His Step-niece Mao When She Comes Home - Mao Watanabe

  • mao watanabe censoredcreampieblowjobLOLglay zloli senkaLOL-194LOL19412lol00194
    • 2021-05-07
    170 min

    [DASD-856]Devilish Young Female Manager Aims For Victory By Sexually Motivating Her Team Kotone Toa

  • toua kotone censoredschoolgirlsingle workDASDdascognac kaminoDASD-856DASD856dasd00856
    • 2021-05-16
    39 min

    FC2PPV 1820967 Affair girlfriend 50th work commemoration RR 100th work commemoration .. Don’t talk about her without seeing this The end of the shock with my goddess!

  • amateur uncensoredfc2
    • 2021-05-21
    155 min

    [JUL-585]I Was Made To Cum Over And Over By My Son's Friend's Uncontrollable Adulterous Fucking... Momoko Isshiki

  • momoko isshiki censoredbig titsmature womanJULmadonnaamazing meatJUL-585JUL585jul00585
    • 2021-05-26
    54 min

    481SACZ-030 Yuko 2

  • amateur censoredmarried womanamateursaczsacz-030sacz030481sacz-030
    • 2021-05-27
    61 min

    336KNB-156 Super masochist wife who applied by saying "To add to life …"! Sexless with my husband for 10 years, but with saffle every month A neat and clean Yariman mature woman is blamed with words and gets excited and squirts a lot whi

  • amateur censoredmarried womansquirtingknbknb-156knb156336knb-156
    • 2021-06-01
    88 min

    451HHH-024 AV First Experience [Overwhelmingly Good Guy Feeling] [I Love Chi ● Ko] [Shining Thigh] It looks simple, but the contents love sex! First check the smell ● This sommelier vs 60 over actor. Witness a loving vaginal cum shot spun across gene

  • amateur censoredcreampieamateurhhhhhh-024hhh024451hhh-024
    • 2021-06-04
    120 min

    [NGOD-149]Being Felt Up By A Millionaire...Wife With Big Tits Gets Fucked By A Charismatic Investor Hana Haruna

  • haruna hana censoredbig titsmature womanNGODjet eizomanji groupNGOD-149NGOD149ngod00149
    • 2021-07-05
    55 min

    493NAEN-063 [Leaked] Elite OL’s vulgar Gonzo ★ Continuous Iki with Oni Back Erica Sasami

  • amateur censoredamateurbeautiful girlnaennaen-063naen063493naen-063
    • 2021-07-24
    71 min

    SIRO-4602 [First Shot] [SSS Class Super Sensitive Body] [Endless Squirting] A Talented Material That Combines The Best Sensitivity With The Best Body Has Appeared. While Fascinating A Technique That Does Not Seem To Be 21 Years Old, She Happily Licks

  • amateur censoredsquirtingamateursirosiro-4602siro4602siro-4602
    • 2021-08-01
    58 min

    10musume 080121_01 Called a Escort and Cum Inside Her Sae Machida

  • amateur uncensored10musume
    • 2021-08-08
    61 min

    HEYZO 2583 Sex With An Amateur Girl In Competitive Swimwear – Satomi Kojima

  • satomi kojima uncensoredcreampiehandjobheyzo
    • 2021-09-03
    176 min

    [CAWD-272]This Real-Life College Girl Who Works At A Wholesome Massage Parlor Is A Pushover Who Can"t Refuse A Proposition, So She Decided To Give Her Customer A Handjob And Now Here She Is, Making Her Debut And Squeezing Out 8 Cum Shots For You

  • mitsuki okina censoredhandjobsingle workCAWDkawaiimamezawa mametarouCAWD-272CAWD272cawd00272
    • 2021-09-10
    172 min

    [IPX-716]Super Eros Company Awakenings In 4 Fucks Exclusive No.2 A Soothing Technician Elder Sister Type All 7 Episodes Featuring Orgasming Cocks In This Super Special Mai Kanami

  • kanna mimai censoredsquirtingslutIPXidea pocketarashiyama michirutissueIPX-716IPX716ipx00716
    • 2021-09-23
    80 min

    435MFC-144 [Sex With A Bunny Girl Who Has Erotic Boobs On Her Bread] Usually She Has A Poker Face And Is A Sexy Bunny Girl Alice, But In Front Of Her Favorite Saffle, She Turns Into A Perverted Rabbit! Pour A Large Amount Of Sperm Into Your Mouth Wit

  • amateur censoredcreampiebig titsmfcmfc-144mfc144435mfc-144
    • 2021-10-01
    240 min

    [CLUB-653]Rejuvenation Massage With A Horny Married Woman 30 - Creampie Negotiation Voyeur

  • censoredcreampiebig titsCLUBhentai gentleman clubCLUB-653CLUB653club00653
    • 2021-10-02
    250 min

    [YMDD-244]Debut While Watching A Shooting -Their Pussies Gets Wet From Others Fucking, And They Can"t Take It-

  • hotaru mori censoredcreampiebig titsYMDDmomotaro video publishinghimrockyoung peachYMDD-244YMDD244ymdd00244
    • 2021-10-16
    141 min

    [DDOB-098]This Dangerous Mama Is Hitting You With M.G.T. Machine Gun Handjob Action & M.G.I. Machine Gun Dirty Talk Chisato Shoda

  • shota chisato censoredmature womanslutDDOBdogmatenunore no obasanDDOB-098DDOB098ddob00098
    • 2021-10-26
    65 min

    STOK-008 Natsu (Natsu Tojo)

  • amateur censoredamateurbeautiful girlstokstok-008stok008stok-008
    • 2021-10-27
    38 min

    FC2PPV 2377322 [38 Minutes 3 Shots] A Younger Sister Who Is Very Similar To The Actress Passed The Interview. Uncut 3 Shots Cum Swallowing. Cum Circle ＃ 17

  • amateur uncensoredfc2



    • Jav Cherry, watch JAV streaming online japanese xxx