censored jav high vision javcensored uniform




FC2HZGDAMBIABWATIDHODVDTTSANMIAAAVSAHDKAWAAAPREDADNNATRPPPDVENXJULNACXWANZEBOD

2021-02-05
122 min

[ONEZ-274]Escort Does Everything You Want Yukine Amazawa vol. 003

  • yukine amazawa censoredcreampieuniformONEZprestigetodoonezONEZ-274ONEZ274118onez00274
    • 2021-02-05
    124 min

    [SKSK-043]Escort. Viva! Illicit Sexual Relations Rina Takase

  • rina takase censoredcreampieuniformSKSKprestigesukesukeSKSK-043SKSK043118sksk00043
    • 2021-02-02
    140 min

    [SDDE-643]In-Flight Sexual Services: Uniform, Lingerie, Or Totally Nude 13 - Pussy Spread Wide For Cowgirl - Black Pantyhose Version

  • aishin shinkawa kiyoshi maihara censoredcreampieuniformSDDEsod createsiberia sakaisenzSDDE-643SDDE6431sdde00643
    • 2021-01-30
    119 min

    [MIAA-384]Doing It With My Girlfriend's Younger Sister Until Morning As We Both Sheltered From The Rain - Rin Kira

  • kira rin censoredcreampiebig titsMIAAmoodyzryo inugamieveryone s porn starMIAA-384MIAA384miaa00384
    • 2021-01-30
    168 min

    [JUFE-254]She Was A S********l Just A Second Ago - Now This Beautiful Girl's Making Her Porn Debut! Miyu Yokozawa, Age 18 - A Quarter Russian, This Is The Shaved Pussy Teen Of Your Dreams, And She's Ready To Squirt In Orgasmic Ecstasy

  • mimu yokozawa censoredsquirtinguniformJUFEfitchJUFE-254JUFE254jufe00254
    • 2021-01-29
    240 min

    [OKAX-699]Groping A Cleaning Lady With A Tasy Ass 4 Hours

  • censoreduniformmature womanOKAXk m producedick mandokuokazuOKAX-699OKAX69984okax00699
    • 2021-01-27
    167 min

    [GAID-015]DM Smartphone Immediate Shooting: Super Rare Live Production Shibuya-Omiya-Ikebukuro - S********ls Only Smartphone Vertically Shot POV Video

  • censoredcreampiebig titsGAIDfirst staraida first starGAID-015GAID015h-491gaid00015
    • 2021-01-26
    140 min

    [SDAB-163]Boyish & Shy. Nana Hayami's SOD-exclusive AV Debut

  • don t be quick censoreduniformschoolgirlSDABsod createkomatsu 17one s youthSDAB-163SDAB1631sdab00163
    • 2021-01-24
    130 min

    [GENM-069]Slut Doesn't Wanna Get Caught Eimi Fukada

  • emi fukada censoreduniformslutGENMgenekig 3GENM-069GENM069genm00069
    • 2021-01-24
    240 min

    [ARAN-014]A Beautiful Girl In A Climax Hell Pictorial A Live Sacrifice Upon The Cruel Execution Chamber Watch Her Drip With Bittersweet, Dangerously Smelling Honey See Her Bearded Clam Twitch And Throb With Spasmic Ecstasy INFERNO BABE ULTRA FILM

  • censoredbeautiful girlbdsmARANbabyentertainmentshiroto musume kyoso kyokuARAN-014ARAN014aran00014
    • 2021-01-24
    125 min

    [GENM-071]Vivid POV - She'll Do Anything To Pay Her Bills Suzu Ayano

  • ayano suzuju censoredsingle workGENMgenekig 3GENM-071GENM071genm00071
    • 2021-01-23
    119 min

    [NNPJ-429]Picking Up Girls - Barely Legal Teens With Big Tits In School Uniforms - I Pretended To Be A Cameraman Looking For Models And An Adorable S********l Working At A Bookstore Let Me Take Her To A Hotel Where I Got To Feel Her Up... And More.

  • censoredcreampiebig titsNNPJnanpa japanNNPJ-429NNPJ429nnpj00429
    • 2021-01-23
    181 min

    [DASD-802]Even So, I Want To Be Sandwiched By Lesbians. High-Quality Edition - Kotone Toa, Mitsuki Nagisa

  • toua kotone scooping censoreduniformlesbianDASDdashajime yanaiDASD-802DASD802dasd00802
    • 2021-01-23
    147 min

    [HND-941]My Girlfriend's Litter Sister Is In Love With Me, So I Secretly Knocked Her Up Toa Nanashima

  • toai nanami censoredcreampieuniformHNDhon nakausa pyonHND-941HND941hnd00941
    • 2021-01-23
    118 min

    [CAWD-166]Arguments, The Doldrums, Boredom... When Things Started To Go Wrong With Our Marriage, I Began To Become Attracted To My Little Sister-In-Law While My Wife Was Committing Infidelity, And Then We Fell In Love And Committed Forbidden Adultery

  • yume kotoishi censoreduniformschoolgirlCAWDkawaiitake dCAWD-166CAWD166cawd00166
    • 2021-01-22
    85 min

    [MBDD-2051]Rio Naruse/An Angel's Soft Skin

  • rio naruse censoredbeautiful girlsingle workMBDDmedia branduniform gravureMBDD-2051MBDD2051301mbdd02051
    • 2021-01-22
    107 min

    [DKD-003]You Said You'll Become A Dad Tomorrow, Are You Sure You Should Be Doing This？ Mizuki Yayoi

  • mizuki yayoi censoreduniformslutDKDdream ticketnishiki sasaDKD-003DKD00324dkd00003
    • 2021-01-22
    139 min

    [BFD-005]The Girl I Like Is Dating My Best Friend Rei Kuruki

  • satoshi kuruki censoreduniformschoolgirlBFDdream ticketikkyu senBFD-005BFD00524bfd00005
    • 2021-01-21
    113 min

    [MILK-101]She's Hitting Me With A Demonically Doting Wild And Crazy Choking Piston-Pounding Cowgirl Fuck! She Loves Her Cousin So Much She's Subjecting Him To Confinement And Now She's Pumping Him With Her Pussy Until She's Drained Hi

  • yoko yamaguchi censoreduniformbeautiful girlMILKmilkMILK-101MILK101h-1240milk00101
    • 2021-01-21
    169 min

    [NHDTB-483]Perverted Private Tutor Anal Fucks A S*****t To Encourage Her To Improve Her Grades 2

  • censoreduniformNHDTBnatural highlemonheart nakajimaNHDTB-483NHDTB4831nhdtb00483
    • 2021-01-21
    303 min

    [SVOMN-152]Surveillance Invasion A Creampie Fuck Fest! A Teacher, A J* A Nurse Are All Getting Fucked And They're Squirting! Squirting! Squirting! 18 Titles A 5-Hour Collection

  • censoredcreampiesquirtingSVOMNsadistic villageSVOMN-152SVOMN1521svomn00152
    • 2021-01-21
    113 min

    [MILK-100]I'm Sorry That My Pussy Is So Hungry Deep And Rich Slobbering Kisses x Juicy Cunnilingus Squishy, Juicy Sex Until The Break Of Dawn With A Horny Sch**lgirl Aoi Kururugi

  • aoi kururugi censoreduniformschoolgirlMILKmilkMILK-100MILK100h-1240milk00100
    • 2021-01-21
    153 min

    [NHDTB-487]A Cafe Girl Chain Reaction Fuck Fest A Chain Reaction Fuck Fest Project That Takes Advantage Of Obedient Cafe Girls Who Cum While They're On The Job

  • censoredbig titsuniformNHDTBnatural highrafting maeshiroNHDTB-487NHDTB4871nhdtb00487
    • 2021-01-21
    212 min

    [NHDTB-485]A Big Tits S********l In Uniform Gets Groped And Grabbed From Behind And Wiggles Her Ass On A Crowded Bus By A Titty Grabbing M****ter 12

  • censoredbig titsschoolgirlNHDTBnatural highjanken kotamaNHDTB-485NHDTB4851nhdtb00485
    • 2021-01-20
    119 min

    [SPZ-1092]Cash For Pics - Beautiful Honor S*****t Is A Secret Slut With Blossoming Tits

  • censoredschoolgirlbeautiful girlSPZstar paradisestar paradiesSPZ-1092SPZ1092h-254spz01092
    • 2021-01-20
    120 min

    [VNDS-5208]Horny MILFs Masturbate In Their Work Clothes

  • yoshiko tozawa nakamoto mika censoreduniformmature womanVNDSstar paradisenext toilet r eVNDS-5208VNDS5208h-254vnds05208
    • 2021-01-20
    99 min

    [MOKO-033]If You Show Your Cock To A Beautiful Mature Woman In A Private Men's Mature Woman...

  • censoreduniformamateurMOKOstar paradisebumpy roadMOKO-033MOKO033h-254moko00033
    • 2021-01-19
    211 min

    [SDAB-162]She Seems So Quiet And Nice, But Her Head Is Filled With Horny Daydream Fantasies An Art S*****t With A Sensual, Slender Body, And Artfully Beautiful Skin An SOD Exclusive Adult Video Debut Saya Kuriyama

  • saya kuriyama censoredamateursingle workSDABsod creatememe akiyamaone s youthSDAB-162SDAB1621sdab00162
    • 2021-01-17
    127 min

    [MRSS-104]I Looked Through My Wife's Phone And Found A Whole Collection Of POV Sex Tapes From The Time She Was A S*****t Made With Her Homeroom Teacher Yui Hatano

  • yui hatano censoredcreampiesingle workMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-104MRSS104mrss00104
    • 2021-01-16
    113 min

    [ROYD-037]I Confessed My Love For The First Time To The No.1 Slut At School! "If We're A Good Match Sexually, I'll Go Out With You!" And Then She Gave My Cherry Boy Cock A Test Ride! Yui Kawai

  • yui kawai censoredcreampieschoolgirlROYDroyalcognac kaminohhh groupROYD-037ROYD037royd00037
    • 2021-01-16
    119 min

    [ROYD-040]Made To Give My Own Slutty Niece Creampie After Creampie Until My Balls Are Drained Dry... Uta Yumemite

  • yumemi teruuta censoredcreampieschoolgirlROYDroyalcognac kaminohhh groupROYD-040ROYD040royd00040
    • 2021-01-16
    121 min

    [SSNI-973]Breaking In S********ls - Middle-Aged Guys With A School Uniform Fetish Nail A Teen Whether She Likes It Or Not... Sayaka Otoshiro

  • otoshiro sayaka censoreduniformbeautiful girlSSNIs1 no 1 stylekitorune kawaguchiSSNI-973SSNI973ssni00973
    • 2021-01-15
    120 min

    [MDTM-696]A Babymaking Story During The Ovulation Period Of A Girl Who Ejaculates Prematurely - Yui Nagase ACT 012

  • yui nagase censoredcreampieuniformMDTMuchu kikakutodoMDTM-696MDTM696h-585mdtm00696
    • 2021-01-15
    122 min

    [YMDD-220]Feels Even Better Than Sex - Honor S*****t Gives A Blowjob Then Takes Her First Ever Facial 11 Girls, Chapter Part 3

  • censoredschoolgirlblowjobYMDDmomotaro eizodukewakamomoYMDD-220YMDD220ymdd00220
    • 2021-01-15
    120 min

    [MDTM-697]Always Looking Down On Me. Galactic Beauties' Service Club - Mitsuha Higuchi vol. 002

  • mitsuha higuchi censoredcreampieuniformMDTMuchu kikakutodoMDTM-697MDTM697h-585mdtm00697
    • 2021-01-15
    220 min

    [BAZX-268]Dirty POV Sex With An Admired Coworker vol. 001

  • censoredcreampieuniformBAZXbazookatodoBAZX-268BAZX268h-1496bazx00268
    • 2021-01-15
    152 min

    [MDTM-699]A Barely Legal Girl For Me Alone, Who Will Let Me Creampie In Her Anytime! Ruka Inaba

  • inaba censoredcreampiebig titsMDTMuchu kikakusuginokiMDTM-699MDTM699h-585mdtm00699
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-15
    241 min

    [MDTM-698]This Sparkling S********l Who Is Sensually Sensitive To Fashion And Sex Is Working At An Excessively Dangerous Underground Part-Time Job 2

  • censoredcreampieuniformMDTMuchu kikakutetMDTM-698MDTM698h-585mdtm00698
    • 2021-01-15
    218 min

    [BAZX-267]POV Sex With A Beautiful Girl In Sailor Uniform vol. 001

  • censoredcreampieuniformBAZXbazookatodoBAZX-267BAZX267h-1496bazx00267
    • 2021-01-15
    129 min

    [GZAP-039]This Girl Dressed In A Uniform With Black Stockings Was Attending A Self-Defense Class, But She Had Her Guard Down So She Was Easy To Fuck LOL And When I Had My Way With Her Sexually During Training...

  • censoredcreampieschoolgirlGZAPprestigezapGZAP-039GZAP039118gzap00039
    • 2021-01-15
    146 min

    [SABA-671]Sharing A Hotel Room With My Coworker After We Went Out And Missed The Last Train... She Seemed So Unguarded, I Couldn't Resist Her... vol. 005

  • censoredcreampieuniformSABAskyu shirototodoSABA-671SABA671h-244saba00671
    • 2021-01-15
    237 min

    [SIM-105]"Hey Teacher, Let's Hurry Up And Fuck" This Private Tutor Is An Excessively Devilish Mofo Who Is Luring His Sch**lgirl Pupil To Temptation, And When They Fuck, He Doesn't Even Bother To Put On A Rubber, And Goes For A Totally

  • censoredcreampieuniformSIMprestigeamateur pussiesSIM-105SIM105118sim00105
    • 2021-01-15
    120 min

    [MDTM-694]It's My Graduation Soon, So... Tsumugi Narita

  • narita tsumugi censoredcreampiebig titsMDTMuchu kikakutodoMDTM-694MDTM694h-585mdtm00694
    • 2021-01-15
    120 min

    [MDTM-695]All POV: Sugar Baby In Uniform Miu Narumi

  • narumi miu censoredcreampieuniformMDTMuchu kikakutodoMDTM-695MDTM695h-585mdtm00695
    • 2021-01-14
    125 min

    [FGAN-032]A Beautiful Girl Who Makes Men Get Erections Unintentionally

  • aya mamiya censoredcosplaysingle workFGANfetish eyesFGAN-032FGAN032h-1440fgan00032
    • 2021-01-12
    122 min

    [KTRA-265]Creampie For My Slender S********l Stepsister Hinako Mori

  • hinako mori censoreduniformslutKTRAk tribeKTRA-265KTRA265h-094ktra00265
    • 2021-01-12
    115 min

    [KTRA-266]Tempted Into Creampie Sex By A Big Titted Stepsister - Aoi Morinaga

  • morinaga aoi censoredbig titsuniformKTRAk tribeKTRA-266KTRA266h-094ktra00266
    • 2021-01-12
    140 min

    [STARS-320]Sweatily Licking And Kissing The Body Of A Beautiful Girl - Mei Miyajima

  • mei miyajima censoreduniformhandjobSTARSsod creategoemonsod starSTARS-320STARS3201stars00320
    • 2021-01-10
    125 min

    [SQTE-352]Naughty Sexy With A Beautiful Y********l In Uniform

  • nanami sena yui kawai censoredschoolgirlblowjobSQTEs cuteSQTE-352SQTE352sqte00352
    • 2021-01-10
    142 min

    [SQTE-354]This Honor S*****t Got So Excited By The Thought Of Choking, Spanking, And Getting Face Fucked She Wet Herself. Sara Kagami

  • kagami sara censoredsquirtinguniformSQTEs cuteSQTE-354SQTE354sqte00354
    • 2021-01-09
    240 min

    [HJMO-450]If You Can Remain Cool And Calm, You'll Win 1 Million Yen! While Trying To Hold In Her Pee, She's On The Phone With Her Boyfriend Take The "You Absolutely Must Not Cum" Challenge! While Getting A Sexual Pranks Sensual Check,

  • censoredsquirtinguniformHJMOhajime kikakukannana dainanaHJMO-450HJMO450hjmo00450
    • 2021-01-09
    114 min

    [MUDR-137]Ever Since That Day... Breaking In A Beautiful Y********l In Uniform With S&M Creampie Sex Mahiro Ichiki

  • mahiro ichiki censoredcreampiebdsmMUDRmukuMUDR-137MUDR137mudr00137
    • 2021-01-08
    183 min

    [NHDTB-478]Annual Custom - Private School Senior's Culture Festival Booth Is Secretly A Swinger's Club

  • censoredschoolgirlNHDTBnatural highlemonheart nakajimaNHDTB-478NHDTB4781nhdtb00478
    • 2021-01-08
    492 min

    [GOAL-036]Passionate Soapland - Wild Sluts And Uniform-Clad Babes Offer Incredible Services - Slippery Mat Play 8 Hours

  • censoredGOALprestigegoalGOAL-036GOAL036118goal00036
    • 2021-01-07
    168 min

    [MADV-502]My Gamer Buddy Was A S********l, So I Invited Her To My Place And Made Her Fuck Me.

  • natsuki kisaragi momoka arisu censoredcreampieuniformMADVcrystal eizoharuo miyafujimaniac crystalMADV-502MADV50249madv00502



    • Jav Cherry, watch JAV streaming online japanese xxx