censored documentary adultery javcensored jav




FC2WAAASPRDSSNIMIDEMIAAMVSDSQTENACXAVSACAWDNATRSANEBODHMNRBDSHKDABWIPXGMEMHND

2020-11-28
159 min

[JUFE-231]Snake Tongue Titty Fuck Servant Training Droopy Tits Finding Out A Hostess Princess' Weakness, We Fuck At A Hotel Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsJUFEfitchJUFE-231JUFE231jufe00231
    • 2020-11-29
    137 min

    [MMKZ-088]This Elder Sister Type Had A Big Ass That Was So Filthy It Blew My Mind In Seconds!! Nanami Matsumoto

  • nana matsumoto censoredbig titssingle workMMKZmarrionkojiro miyamotoirisMMKZ-088MMKZ088mmkz00088
    • 2020-11-30
    75 min

    484SD-002 If you talk to a gal who was dancing while drinking in front of the station, the super famous Tik T ○ ker will be listed in the ranking! ？？ Let’s take a picture with a camera! He was a super erotic dancer who would blow up to the tide

  • amateur censoredsquirtingamateursdsd-002sd002484sd-002
    • 2020-12-01
    120 min

    [NACR-379]The Fortune-Teller Everybody's Talking About Maron Natsuki

  • marin natsuki censoredbig titsslutNACRplanet plusbito sakurananakuruNACR-379NACR379h-237nacr00379
    • 2020-12-07
    94 min

    300MIUM-655 Cheating addictive hypersexual wife! !! !! → [Abnormal sexual desire floats so much that if there is a type, it will be reversed! !! !! ] × [Anyway, “Beauty” & National Treasure-class beauty big breasts & bicubic convuls

  • amateur censoredcreampiesquirtingmiummium-655mium655300mium-655
    • 2020-12-14
    57 min

    328HMDN-320 [Athletic club college student x married woman 3P] Plump K cup big breasts wife 37 years old Married woman’s sexual curiosity, aphrodisiac with 3P with athletic club boys, full-body convulsions

  • amateur censoredcreampiebig titshmdnhmdn-320hmdn320328hmdn-320
    • 2021-01-08
    240 min

    [SOUD-023]Aggressive Slut Devours Dick Purely By Instinct In Super Perverted Sex Session!!

  • censoredamateurslutSOUDprestigebest fuckingSOUD-023SOUD023118soud00023
    • 2021-01-14
    62 min

    230OREC-669 Hikari

  • amateur censoredcreampieamateurorecorec-669orec669orec-669
    • 2021-01-23
    119 min

    [NNPJ-429]Picking Up Girls - Barely Legal Teens With Big Tits In School Uniforms - I Pretended To Be A Cameraman Looking For Models And An Adorable S********l Working At A Bookstore Let Me Take Her To A Hotel Where I Got To Feel Her Up... And More.

  • censoredcreampiebig titsNNPJnanpa japanNNPJ-429NNPJ429nnpj00429
    • 2021-02-10
    71 min

    SWEET-050 Rinori

  • amateur censoredschoolgirlamateursweetsweet-050sweet050sweet-050
    • 2021-02-12
    199 min

    [HJMO-452]The Sexy Dual Hostesses Everybody's Talking About! Reserve Their Incredible Big Tits For Your Fondling! Also Available For A Passionate Three-Some Orgy!

  • censoredcreampiebig titsHJMOhajime kikakuHJMO-452HJMO452hjmo00452
    • 2021-02-13
    61 min

    FC2PPV 1684482 ★ First shot amateur wife ☆ Pocha Lori busty big ass young wife Marimo 23 years old ☆ Even though she is newly married, she is disturbed by another stick ♥ De nasty blowjob ♥ I made a lot of vaginal cum shot in a sensitive pussy! [Pers

  • amateur uncensoredfc2
    • 2021-02-18
    151 min

    [JJBK-040]MILFs Only - Hidden Camera Voyeur Footage Of Mature Sluts Taken Home To Fuck - Then Sold As Porn 38 - Cougar Thirsty For Young Cock Moans As She Gets Plowed Edition - Ms Sachiko, G-Cup, Age 40, 5Ɗ", Sexy Tanned Nympho, Ms Toshimi,

  • censoredmature womanJJBKjukujo bank emmanuellemanji groupJJBK-040JJBK040jjbk00040
    • 2021-03-05
    80 min

    259LUXU-1393 A beautiful woman who works on the production of Luxury TV 1374 AI and who is just right for the word “talented” decides to appear on AV with the intention of releasing the desire to lose her place. She oozes her love juice in

  • amateur censoredamateurluxuluxu-1393luxu1393259luxu-1393
    • 2021-03-05
    66 min

    [SZKK-021]My Wife Would Never...~ Beautiful Wife Gets Fucked By Another Man ~ R-18 / Kumi Maeda

  • maeta kumi censoredsoloworkSZKKorustak softmasturbation supportSZKK-021SZKK021
    • 2021-03-13
    120 min

    [IPX-632]A One-Price Married Woman A Fuck-All-You-Want Subion My Husband Could Never Satisfy Me, So I Degraded Myself To The Lowest Form Of Work I Could Find Nanami Misaki

  • nanami misaki censoredsingle workdramaIPXidea pocketjo asagiridishIPX-632IPX632ipx00632
    • 2021-03-18
    120 min

    [SSIS-022]S*********ls Sell Their Bodies To Older Men For Extra Money Aqua Yamazaki

  • mizuyama yamazaki yukina shida censoreduniformbeautiful girlSSISs1 no 1 stylekc takedaSSIS-022SSIS022ssis00022
    • 2021-03-18
    147 min

    [MVSD-458]High Class Married Woman Becomes A Streetcorner Slut - I Can't Believe I Got To See Her Like This, Let Alone Make My Stepmom Cum

  • censoredcreampiebig titsMVSDm s video groupbungo maedaMVSD-458MVSD458mvsd00458
    • 2021-03-18
    154 min

    [DVDMS-646]"You Get Hard When Somebody Touches Your Nipples... Are You A Perv？" The Married Woman Next Door Teases The Nipples Of A Guy Who Happens To Be A Total Sub - This MILF Slut Loves Every Minute Of Milking His Dick, Edging Out Every La

  • censoredbig titsamateurDVDMSdeep sswing nagaseDVDMS-646DVDMS646dvdms00646
    • 2021-03-25
    131 min

    [MOND-212]With My Female Supervisor Crush Akari Niimura

  • akari shinmura censoredsingle workMONDtakara eizohotate ikkandaiichi housouMOND-212MOND21218mond00212
    • 2021-04-02
    70 min

    328HMDN-350 [Individual / F Cup] Cheating Athlete Wife 47 Years Old And Creampie Affair. Beast sex that shakes hips with a young raw meat stick to devour

  • amateur censoredcreampiemarried womanhmdnhmdn-350hmdn350328hmdn-350
    • 2021-04-02
    60 min

    FC2PPV 1751915 [Limited to 100 pieces, 1000 off] Everyone’s Tsu ● Ha ~ ♪ Familiar Tsu ● Had ● Serious 20-year-old working with a boogie ❤️ Untreated pubic hair ❤️ Squirting with an electric massager ❤️ First medium Iki ❤️ A simple girl is insert

  • amateur uncensoredfc2
    • 2021-04-23
    57 min

    FC2PPV 1782414 Yuika 20 years old Absolutely beautiful girl! Pure white mochi fluffy mozzarella body job hunting student! It’s super sensitive and cums while wearing a suit! A transcendent beautiful girl’s fluffy shaved pussy is seeded and

  • amateur uncensoredfc2
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-04-29
    34 min

    FC2PPV 1792287 [Leaked] Bring back the fair-skinned girl who spoke at the pubsta and fuck it as it is! How about a child with a fair-skinned pink nipple on a slightly whip body？

  • amateur uncensoredfc2
    • 2021-05-14
    55 min

    518ASGM-002 [Sleep Fucking / Intravaginal Ejaculation] Intelligent Black Hair Beautiful Girl М (Saitama / Private / Selection Class) Estimated C Cup

  • amateur censoreduniformamateurasgmasgm-002asgm002518asgm-002
    • 2021-05-28
    62 min

    FC2PPV 1841311 [No / individual] God-friendly !？ SEX with a cute girl who looks like Haruka Shimazaki! An angelic bitch who gives a blow job and vaginal cum shot with a smile even though she has a virgin face! !! * There is an appearance review privi

  • amateur uncensoredfc2
    • 2021-06-07
    53 min

    416SVMM-050 Marina

  • amateur censoredcreampiesquirtingsvmmsvmm-050svmm050416svmm-050
    • 2021-06-12
    122 min

    [SABA-700]Adultery Raw Sex With A Horny Married Woman On Her Dangerous Days - The Case Of Mrs. Sai (Fake Name), Married For 5 Years

  • censoredcreampieblowjobSABAskyu shirototodoSABA-700SABA700saba00700
    • 2021-07-17
    65 min

    300NTK-604 [Dirty Breasts Country Yankee Beauty De Nasty Theory! !! ] At First I Thought It Was A Mine Gal …! !! Get Acquainted With An Uncle In The City And Start A Rich Service! !! A Full Course Of Lewd Tech Polished By Locals, Of Course, Free

  • pgal censoredcreampiebig titsntkntk-604ntk604300ntk-604
    • 2021-08-13
    295 min

    [SKMJ-196]40 Days Worth Of Peeping Videos! Only A Camera Installed By A Fellow Clan Member Could Get This Close To Big And Little Stepsister Panty Shot Action And No Makeup Body Washing Action Like This In Such Vulnerable Positions, Now Made Public F

  • censoredamateursisterSKMJsekimenjoshisekimen goshiSKMJ-196SKMJ196h-1324skmj00196
    • 2021-08-19
    67 min

    OREX-286 Natsu-chan 2

  • amateur censoredcreampieamateurorexorex-286orex286orex-286
    • 2021-08-26
    49 min

    H4610 ki210826 Seiko Kuramoto 26years old

  • amateur uncensoredh4610
    • 2021-09-01
    134 min

    [GVH-282]A Woman Possessed With Exhibitionist / G*******g / Bukkake Desires Rin Miyazaki

  • miyazaki rin censoredslutsingle workGVHglory questusubashi suiGVH-282GVH28213gvh00282
    • 2021-09-04
    134 min

    [MDUD-464]Wataru Ishibashi"s Amateur Creampies 5

  • censoredcreampieamateurMDUDartmodeishibashi wataruMDUD-464MDUD464mdud00464
    • 2021-09-08
    55 min

    416SVMM-052 Kaori

  • amateur censoredanalcreampiesvmmsvmm-052svmm052416svmm-052
    • 2021-09-10
    119 min

    [DASD-912]Light Skin Slender Girlfriend Cheats On Me With My Dad And Gets Fucked. Hono Konomi

  • yoshimi hono censoredcreampieschoolgirlDASDdasrokusaburo mishimaDASD-912DASD912dasd00912
    • 2021-09-16
    134 min

    [IORA-009]"Those Filthy Extra Hairs, Fluttering In Breeze, Are Absolutely Not Unnecessary!" This Beautiful Married Woman Is Lifting Her Arms Up In A Banzai Pose, Exposing Her Underarm Hairs, And Enjoying Creampie Sex!! Here Is Suzune Ozawa, 3

  • suzune ozawa censoredcreampiemarried womanIORAcenter villagejiro fukagawazora center villageIORA-009IORA009h-086iora00009
    • 2021-09-22
    59 min

    415LAS-039 Nozomi

  • amateur censoreduniformschoolgirllaslas-039las039415las-039
    • 2021-09-29
    65 min

    491TKWA-189 H Cup Big Tits J ● And Uniform Creampie Raw Saddle! (Riho Takahashi)

  • amateur censoredcreampiebig titstkwatkwa-189tkwa189491tkwa-189
    • 2021-10-20
    124 min

    [GVH-307]Father In Law and Daughter In Law, Close Creampie and Sex. Sakura Tsuji.

  • sakura tsuji censoredcreampiegrandfatherGVHglory questtakahashi chitsujiGVH-307GVH307gvh00307
    • 2021-10-23
    240 min

    [EYS-070]Picking Up Gals And Taking Them Home Highlights, Old Man Fucking! 12 Tsundere Specially Selected Women Make You Crazy 4 Hours

  • censoredcreampieamateurEYSstudio i sEYS-070EYS070eys00070
    • 2021-11-11
    112 min

    [GUN-864]Incontinent Deep Throat: Alice Otome

  • otsu alice censoredbig titssquirtingGUNradixsakuraba kyuu kokoro otokobatsugunGUN-864GUN864433gun00864
    • 2021-11-11
    125 min

    [ARMF-020]A Lusty Married Woman Full-Body Pictorial No.1

  • kobayakawa reiko tsukishima sakura censoredanalmature womanARMFaroma kikakunyotai fetishismARMF-020ARMF020armf00020
    • 2021-11-12
    167 min

    [EBOD-866]Kind Nature But Extreme Backdoor Option Service!？ Masseuse That Keeps Plump Men Constantly Firing. Ichika Seta

  • kazuhana seta censoredcreampiebig titsEBODe bodyoosaki hirokoujiEBOD-866EBOD866ebod00866
    • 2021-11-25
    130 min

    [STARS-473]体の相性が最高なコンビニパート主婦Mさんとは休憩2時間のショートタイム密会でも最低3回は射精(だ)せる 宮島めい

  • miyajima mei censoredmarried womanSTARSsod createkazuie toyotaSTARS-473STARS473
    • 2021-11-25
    117 min

    [SPRD-1488]Surrogate Mother Hana Haruna

  • haruna hana censoredcreampiemature womanSPRDtakara eizosanpei suminekoaleddinSPRD-1488SPRD148818sprd01488
    • 2021-12-01
    126 min

    [AMBI-147]Runaway Girl And Old Guy Small Love Story. Tsurara Kanon

  • hanaoto urara censoredcreampieschoolgirlAMBIplanet plusdirector oanbibarentsuAMBI-147AMBI147h-237ambi00147
    • 2022-01-05
    86 min

    SMUK-083 Miina (Miina Konno)

  • amateur censoredcreampieuniformsmuksmuk-083smuk083smuk-083
    • 2022-01-14
    50 min

    [ETQR-342][Daydream POV] Total Obedience, Ovulation Day, Slut Maid, And Sex To Have C***dren. Kiu Aihara.

  • aihara tsukiha censoredcreampieblowjobETQRerotic timeETQR-342ETQR342etqr00342
    • 2022-01-22
    155 min

    [BDSR-469]Female Friend Comes Over To Stay The Night After Missing The Last Train, Finding A New Realization In Having Sex All The Time. Vol. 1. Shiori-chan For Voyeur, Big Vibrator Teasing, Lotion Play, Sex All Day And Night.

  • censoredcreampieamateurBDSRbig morkalBDSR-469BDSR46957bdsr00469
    • 2022-01-22
    176 min

    [LZDM-047]Lesbian Friends ~ First And Last Lesbian Sex With My Best Friend HX

  • ichika matsumoto momose asuka censoredschoolgirllesbianLZDMlesrenao masakilezure dramaLZDM-047LZDM047lzdm00047
    • 2022-01-22
    240 min

    [OKAX-808]This Older Female Hotel Employee Will Let You Fuck Her On The Job! 4 Hours

  • censoredamateurmature womanOKAXk m producedick mandokuokazuOKAX-808OKAX808okax00808
    • 2022-02-11
    241 min

    [FOOM-002]A Cute Face And A Great Blowjob - Licking And Sucking With Harcore Techniques BEST

  • ena satsuki lara kudo censoredbig titsblowjobFOOMabc mousouzokufocusFOOM-002FOOM002foom00002
    • 2022-02-14
    26 min

    FC2PPV 2663934 [Personal Shooting / Creampie] A 26-Year-Old Married Woman With Big Tits Who Likes Fathers Blamed Sm Chick For Screaming …

  • amateur uncensoredfc2
    • 2022-03-01
    136 min

    [DOKS-555]Transcendental Frustrated Nasty Slut With Colossal Tits And Breast Milk - Hinami Narusawa

  • hinami narusawa censoredslutsingle workDOKSoffice k 039 somutsu sukebeiDOKS-555DOKS55536doks00555



    • Jav Cherry, watch JAV streaming online japanese xxx