censored beautiful girl javcensored amateur high vision




FC2ROYDVENUSTARSDASDWANZHODVPREDSSNISQTEPPPDMVSDADNSHKDMIAAGMEMFSDSSSSISWAAAHNDNNPJ

2020-11-01
57 min

324SRTD-0198 The celebrity office lady who applied was super erotic and was a master of blowjob w

  • amateur censoredamateursrtdsrtd-0198srtd0198324srtd-0198
    • 2020-11-05
    78 min

    AVKH-183 Bandai tsubaki

  • amateur censoredbig titsamateuravkhavkh-183avkh183avkh-183
    • 2020-11-11
    58 min

    FC2PPV 1566384 [Personal shooting / set sale] Immediately before the wedding ceremony, the wife who wants to record the last sex with another stick ① & ②

  • amateur uncensoredfc2
    • 2020-12-04
    40 min

    480FRIN-010 《Personal shooting》 Dream chasing idol 19 years old Private SEX with variety show director Creampie

  • amateur censoredcreampieamateurfrinfrin-010frin010480frin-010
    • 2020-12-13
    104 min

    [BADA-009]Addicted To Adultery - Wife (28) Can't Slake Her Cheating Lust Yumina Hirosaki

  • yumina hirosaki censoredmarried womanblowjobBADAvartanyoshida great buddhadiamondBADA-009BADA009bada00009
    • 2020-12-20
    63 min

    413INST-080 [Gravure production outflow] Top secret personal photo session with that topical gravure idol

  • amateur censoredcreampiebig titsinstinst-080inst080413inst-080
    • 2020-12-25
    51 min

    [MASE-009](Online Only) Madam In Her Forties - Wealthy Wife - Horny & Creampie-Crazed

  • censoredcreampiemarried womanMASEcrystal picturemadam maniac plusMASE-009MASE00949mase00009
    • 2021-01-16
    122 min

    FC2PPV 1646786 [Creampie 2 barrage] If you get caught in the shop, the ban is confirmed! During life from Menes hidden shooting → Super rich sex of cleaning blowjob × 2

  • amateur uncensoredfc2
    • 2021-01-20
    115 min

    [EMOI-045]Creampie POV / Her First Time Swallowing Cum In A Blowjob / First Time Showing Her Face With No Makeup / Frank 1-to-1 Talk / Beach Date In Shonan / Mao Watanabe (20)

  • mao watanabe censoredcreampieEMOIsod createtanaka baconemo girlEMOI-045EMOI0451emoi00045
    • 2021-01-22
    482 min

    [KPB-014]An Absoutely Sure Thing Beautiful Slut Adult Video Maker KANBi Best Hits Collection 8 HOurs Vol.3 6 First Time Shots Debut Videos Featuring Beautiful Married Woman Babes That Made History In This Super Select Collection!!

  • airi takasaka mina hasegawa censoredcreampiebig titsKPBprestigekanbiKPB-014KPB014118kpb00014
    • 2021-01-29
    79 min

    300MIUM-667 That’s a woman who doesn’t refuse! !! !! [Erotic deviation value SSS class beauty who will grant anything selfish! !! !! ] × [Transcendence sensitive constitution & de M throat metamorphosis faucet Ma ● This is a violent tre

  • amateur censoredamateurmiummium-667mium667300mium-667
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-11
    93 min

    [OKK-023]Wet And Shiny And Tight A Goddess In A Competitive Swimsuit Runa Tsukino Enjoy A Cute Lolita In A Competitive Swimsuit To Your Heart's Content! Watch Them Change In Peeping Videos, And Check Out Their Tiny Titties, Big Tits, And Shaved P

  • tsukino luna censoredbeautiful girlsingle workOKKdaddy s private photosgodly swimming raceOKK-023OKK0231okk00023
    • 2021-02-11
    128 min

    [MEKO-204]All New "The Old Lady Rental" Service 08 I Heard About This Housecleaning Service That Would Let You Have Creampie Sex, So I Decided To Make Even More Extreme Demands

  • censoredcreampieamateurMEKOmature woman laboMEKO-204MEKO204h-1160meko00204
    • 2021-02-12
    117 min

    [MEYD-657]The Boss Is Away So For Three Days A Horny Married Slut Takes Creampies On The Job - Wild Nympho Record Hana Himesaki

  • himesaki hana censoredcreampiebig titsMEYDtameike gorohirokoji osakiMEYD-657MEYD657meyd00657
    • 2021-02-24
    40 min

    [SDFK-042]"Couples Only" In The One-Way Mirror Cab, Your Girlfriend Tries Out A Real Cheating Creampie! Mika (18), College S*****t

  • censoredSDFKsod createyoshiaki nomotomagic mirrorSDFK-042SDFK0421sdfk00042
    • 2021-02-26
    35 min

    FC2PPV 1703388 [No mode] Final interview with raw vaginal cum shot of abuse of authority. Misunderstanding job hunting students who dislike blowjobs are sanctioned by Tekken with slap w Then, by the time they lick anal, education is completed and con

  • amateur uncensoredfc2
    • 2021-03-06
    138 min

    [JBD-263]Servant Contract - Shihori Kotoi

  • shiori kotoi censoredbdsmsingle workJBDattackersjo asagirijabakuJBD-263JBD263jbd00263
    • 2021-03-12
    348 min

    [SUPA-576]Tokyo Amateur - Raw Fucking Leaked pictures 3

  • censoredschoolgirlamateurSUPAskyu shirotoSUPA-576SUPA576h-244supa00576
    • 2021-03-18
    480 min

    [HHOY-009]Your Stepmom Acts Like She Doesn't Want It, But She Gives In, In The End Highlights Collection - Stepmoms Transform Into Sluts For Their Stepsons' Dicks - And His Friends'

  • censoredmature womanHHOYoyashoku.companyhhh groupHHOY-009HHOY009hhoy00009
    • 2021-03-25
    108 min

    [SPRD-1392]Creampie Relations With My Kind Step Mother... Emi Toda

  • emi toda censoredmature womansingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1392SPRD139218sprd01392
    • 2021-03-26
    58 min

    383REIW-050 Natsume

  • amateur censoredbig titsamateurreiwreiw-050reiw050383reiw-050
    • 2021-04-06
    55 min

    FC2PPV 1750519 Finally Gonzo production lifted ❤️ It turns out that that God milk Menes Miss Sakura was actually a masochistic nympho ❤️ Seriously died 3 times with horse riding both legs closed play Many purchase benefits

  • amateur uncensoredfc2
    • 2021-04-17
    229 min

    [REXD-361]While You Were Away At The Office... Your Father Came Inside Me "My Son Isn't Enough To Satisfy You, Is He？ How About Me？"

  • censoredcreampieREXDredmanji groupREXD-361REXD361rexd00361
    • 2021-04-18
    120 min

    [GBSA-067]Filming Trip - Mimika Toda

  • mika toda censoredsingle workGBSAgogos black mousouzokukoichi takahashigogosGBSA-067GBSA067gbsa00067
    • 2021-04-23
    84 min

    HEYZO 2524 Loli Wife Enjoying Playing Husband And Sex Orgy -Mr. and Mrs. Sasagawa 2- – sasagawa pearents&myu

  • amateur uncensoredheyzo
    • 2021-05-08
    131 min

    [BAHP-080]Breaking In Request Documentary - Miko Horima

  • mami hori censoredbeautiful girlsingle workBAHPbaltanusubashisuihoppinBAHP-080BAHP080bahp00080
    • 2021-05-10
    54 min

    358WITH-100 Arisa (20) S-Cute With Girl Who Wants To See Touched And Gonzo H

  • amateur censoredcreampiesquirtingwithwith-100with100358with-100
    • 2021-05-15
    115 min

    [MRSS-112]A Cuckolding Babymaking Vacation I Went With My Wife On A Vacation So That We Could Try To Make Babies While She Was Ovulating, But Then This Male College S*****t Creampie Fucked Her Instead Amu Hanamiya

  • hanamiya amu censoredcreampiebig titsMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-112MRSS112mrss00112
    • 2021-05-20
    121 min

    [DLDSS-006]Step Mother Lover My Incredible Step Mom Craves Me Every Day Ayaka Tomoda

  • ayaka tomoda censoredcreampiesingle workDLDSSdahliapassionate employeeDLDSS-006DLDSS0061dldss00006
    • 2021-05-21
    119 min

    [NNPJ-447]I Seduced This Super Cute Gal Who Wanted To Be Popular On Social Media So I Seduced Her By Saying, "I Know A Great Spot For Taking Photos!" And That Got Her Super Excited, And Then We Went With The Flow, And I Fucked Her, And I'

  • censoredcreampieamateurNNPJnanpa japanNNPJ-447NNPJ447nnpj00447
    • 2021-06-10
    147 min

    [SPRD-1423]Seductive MILF Friends Hana Haruna

  • haruna hana censoredsingle workSPRDtakara eizokon oriharualeddinSPRD-1423SPRD142318sprd01423
    • 2021-06-16
    115 min

    [083PPP-2167]ボリュームのあるオバさん10人！爆乳とデカ尻に辛抱たまらん

  • amateur censoredbig titsmarried womanpppppp-2167ppp2167083ppp-2167
    • 2021-06-19
    115 min

    [CAWD-235]While My Girlfriend Was Away On A Training Seminar, I Spent The Next 3 Days With My First Love, An Ex-Girlfriend Whom I Could Never Forget, And We Fucked Like Crazy Yuika Aoi

  • yuka aoi censoredsingle workdramaCAWDkawaiitake dCAWD-235CAWD235cawd00235
    • 2021-07-06
    51 min

    188HINT-0464 Misaki

  • amateur censoredcreampiemarried womanhinthint-0464hint0464188hint-0464
    • 2021-07-23
    132 min

    [BAB-030]A Video Of An Almost-Virgin's First Experience Giving A Blowjob

  • censoredBABbabylon daydreamersBAB-030BAB030bab00030
    • 2021-07-29
    48 min

    C0930 ki210729 Shizue Kihara 34years old

  • amateur uncensoredc0930
    • 2021-07-30
    477 min

    [OFJE-325]A Huge Collection of Big Titties In Knitwear To Sporty Clothes! Big Boobed Beauties Being Fucked Fully Clothed-36 BEST 8 Hours

  • yumeno aika evening beauty censoredbig titsOFJEs1 no 1 styleOFJE-325OFJE325ofje00325
    • 2021-07-31
    134 min

    [CMC-259]The Law Of Lesbos Fierce Emotions Of The Female Bondage Master

  • yuki hiraoka kasumi kasumi censoredlesbianbdsmCMCcinemagicganjicollectCMC-259CMC259cmc00259
    • 2021-08-12
    158 min

    [SVDVD-872]My Big Stepsister Is A Reggae Dancer Who Likes To Shake Her Big Ass, And Then With Her Friend, Who Also Has A Great Big Ass, They Like To Take Things Even Further By Doing A Double Grind Cowgirl On Me And Showing Off Their Assholes And Dra

  • hamazaki mao yuuki akagi censoredcreampiedramaSVDVDsadistic villageonipanSVDVD-872SVDVD8721svdvd00872
    • 2021-08-14
    46 min

    404DHT-0092 A Real Virgin Who Captures A Forty Mature Woman! Saya 41 Years Old

  • amateur censoredamateurmature womandhtdht-0092dht0092404dht-0092
    • 2021-08-27
    68 min

    FC2PPV 2085735 (2nd Appearance) A Bewitching Mature Woman In The Neighborhood Who Ejaculates 6 Times A Day

  • amateur uncensoredfc2
    • 2021-09-06
    69 min

    FC2PPV 2158392 Active Third Grader Of Fair-Skinned Beautiful Milk E Cup. Although She Is A Small Animal Raised In The Countryside, A Large Amount Of Love Juice Overflows From Her Vagina. She Secretly Half Vaginal Cum Shot While Watching The Swaying B

  • amateur uncensoredfc2
    • 2021-09-25
    156 min

    [MADV-512]C***dhood Friend That"s Completely Sex Crazed From Breaking In Is Given Over To A Serious Friend. Aoi Kururugi

  • aoi kururugi censoredcreampiebeautiful girlMADVcrystal eizoupearlrice sakagamimaniac crystalMADV-512MADV512madv00512
    • 2021-10-08
    170 min

    [IPX-734]Flirtatious Lovestruck Couple Experience: Soothing Deep Kisses, Naughty Techniques, And Endless Sex! Starring Mai Kanami

  • kanna mimai censoredblowjobsingle workIPXidea pocketkyouseitissueIPX-734IPX734ipx00734
    • 2021-10-09
    114 min

    [BABM-004]Sweet And Cute Waka Acts Like A Mommy To Give Me Smothering Praise And Baby Me While Offering Tons Of Sex. Waka Misono

  • misono waka censoredcreampiebig titsBABMkaguya hime pt mousozokuyumesaki ichiroubabubabu no jitsuBABM-004BABM004babm00004
    • 2021-10-21
    205 min

    [SW-806]Black Pantyhose On This Female Employee For See-thru Panty Shot Temptation! Giving A Foot Massage With Sensitive Thighs And Ass Twitching In Full View. Around The Office, Business Trips, At Home, Just Enjoying Hot Pantyhose Play All Over The

  • censoredSWswitchyocchanswitch hibinoSW-806SW8061sw00806
    • 2021-12-02
    693 min

    [AKDL-155]Amateur Year-end Special! "Can You Put Your Dick In Me？" We Interviewed And Fucked An Amateur Who Was Interested In Sex.

  • censoredamateurAKDLakinoriakinoriAKDL-155AKDL1551akdl00155
    • 2021-12-09
    174 min

    [DANDY-790]At A Mixed Bathing Hot Springs We Thought Was Secluded, A Beautiful Lewd Woman Who Enjoys Men And Women Gets Couples To Have Non-stop Adulterous Threesomes.

  • censoredlesbianDANDYdandybacon tanakaDANDY-790DANDY7901dandy00790
    • 2021-12-10
    99 min

    FC2PPV 2504520 Wrestling Mask Men’s Esthetic Technique Collection Vol.34

  • amateur uncensoredfc2
    • 2021-12-10
    137 min

    [ROE-028]My Mother Is Getting Remarried... I"m So Jealous I Can"t Stop Myself From Fucking

  • good miki ryoko izawa miki yoshii censoredcreampiemature womanROEmadonnaunicorn fukudamonroeROE-028ROE028roe00028
    • 2021-12-13
    60 min

    FC2PPV 2514180 ☆ First Shot ☆ Complete Appearance ☆ Lady Who Loves Sex JD ♥ Blame The Obedient Beautiful Girl And Release A Large Amount Of Thick Semen! 【Selfie】

  • amateur uncensoredfc2
    • 2021-12-17
    120 min

    [EBOD-882]I Used This Hookup App (T*nd*r) That Has Lots Of Young And Cute Girls Online To Meet Rima-chan (20 Years Old), A Beautiful Girl With F-Cup Tits And A Super Sexy Tight Waist Who Works At A Popular Concept Cafe In Ka**kicho, And I Got All The

  • censoredcreampiebig titsEBODe bodymichiru arashiyamaEBOD-882EBOD882ebod00882
    • 2022-01-08
    119 min

    [KAGP-212]The Best Sluts Can Suck Cock Without Using Their Hands! 4 10 Amateur Girls Give Blowjobs Without Using Their Hands

  • censoredamateurblowjobKAGPkaguyahimept mousouzokuokina tsumadorinoprincess kaguya ptKAGP-212KAGP212kagp00212
    • 2022-01-08
    46 min

    ORE-813 Waka (Waka Misono)

  • amateur censoredbig titsamateuroreore-813ore813ore-813
    • 2022-01-22
    120 min

    [JBJB-028]わたしドMなおじさんが大好き！中年チ●ポに興味ありすぎる好奇心旺盛ピュア美少女 桜井千春

  • chiharu sakurai censoredblowjobbeautiful girlJBJBsharkjabujabu machiJBJB-028JBJB028h-687jbjb00028



    • Jav Cherry, watch JAV streaming online japanese xxx