big tits swimsuit high vision creampie




FC2APODROYDAMBIVEMAVENUMVSDSTARSMIAANACRFSDSSHNDCESDWAAAMILKHUNTBGVHAWDCJODPPPDAUKG

2020-11-28
143 min

[WAAA-014]Already 10 Years Since I Started Pleasing My Step Brother And It Continues Now Even Though He Still Lives With Our Step Parents. Mahiru Ichiki

  • mahiro ichiki censoredblowjobhandjobWAAAwanz factorywanzWAAA-014WAAA014waaa00014
    • 2020-11-29
    140 min

    [MRSC-006]"Why Are You Stealing Underwear From An Old Lady Like Me...？" 2 This Married Woman Was Being Neglected By Her Husband, And When She Got Her Panties Stolen, That Flipped Her Horny Switch! 13 Ladies, All In Exclusive, Freshly Filmed F

  • censoredcreampiemarried womanMRSCmrs emmanuelwife s trapmrs faceMRSC-006MRSC006mrsc00006
    • 2020-11-29
    133 min

    [CHCH-002]We Were Doing A Town Hall Cleanup And This Colossal Tits Slut Housewife Was Wearing Tight Pants Over Her Big Ass And Shaking Her Butt To Lure Me To Temptation Rumi (30 Years Old)

  • censoredcreampiemilfCHCHbreasts and mother emmanielbreasts and motherCHCH-002CHCH002chch00002
    • 2020-12-01
    111 min

    [SCR-257]A Married Woman Falls At A Hot Springs Inn! Unscrupulous Oil Masseuse Voyeur Video

  • censoredcreampieSCRglay zs crimeSCR-257SCR25712scr00257
    • 2020-12-10
    55 min

    230OREC-651 Tanaka

  • amateur censoredcreampiebig titsorecorec-651orec651orec-651
    • 2020-12-12
    160 min

    [IPIT-012]Business Trip Shared Room NTR This Blonde Female Employee Was Cumming All Night With Her Horny Boss This Video Features 8 Cum Shots In One Night Of Semen-Slathered Orgasmic Cuckold Sex! Emma Lawrence

  • emma lawrence censoredblowjobIPITidea pocketbungo maedaaipoke excavation projectIPIT-012IPIT012ipit00012
    • 2020-12-20
    73 min

    300NTK-487 Gachi whitening G cup lingerie shop beauty is really erotic theory! ？？ Check how to use the bat on the batting cage and be confident! !! Check out the meat bat usage directly at the love hotel! !! Demonstration of a countdown blow job to h

  • amateur censoredcreampieamateurntkntk-487ntk487300ntk-487
    • 2020-12-25
    305 min

    [MDTM-691]Breeding Sexy Young Maids 10 Girls, 305 Minutes

  • real village henan natsuko mishima censoredcreampieMDTMuchu kikakuMDTM-691MDTM691h-585mdtm00691
    • 2020-12-27
    240 min

    [MCSO-006]The Best Big Asses! Cumming While Being Piston Fucked Hard As Her Asshole Twitches

  • censoredMCSOmercurypremier dreamMCSO-006MCSO006h-1133mcso00006
    • 2021-01-02
    125 min

    [ARM-939]I Will Take Care Of Your Masturbation From Morning Until Night. A Tough Schedule With 6 Ejaculations Per Day!

  • play hatsushima ui censoredanalARMaroma planningmania satoshiaromaARM-939ARM939arm00939
    • 2021-01-05
    46 min

    1Pondo 010521_001 Glamorous: Yusa Minami

  • amateur uncensored1pondo
    • 2021-01-09
    156 min

    [EBOD-797]Sparkling Like Snow - 20 Minutes Of Adultery At A Hotel With Your Busty, Lusty College S*****t Lover

  • censoredbig titsEBODe bodynaveEBOD-797EBOD797ebod00797
    • 2021-01-29
    50 min

    Pacopacomama 012821_427 Wives Drink Cum 116 Kanon Mikoshiba

  • amateur uncensoredpacopacomama
    • 2021-02-04
    90 min

    [MESU-082]I Asked For The Number One Bubble Princess At A High Class Bathhouse, And To My Surprise, Out Came This Old Lady!？ But 2 Hours Later, I Was Sucked Dry To The Bone... This Is What It Means To Experience The Legendary Fully Ripe Creampie Bath

  • yumiko sakura censoredcreampiemature womanMESUcenter villageshibuyared snowMESU-082MESU082h-086mesu00082
    • 2021-02-06
    71 min

    FC2PPV 1674630 [No] ♀268 Gravure ◯ -chan 19 years old, ♀280 Gravure Mizu ◯ -chan 20 years old 1st (3P) New Year’s Ox Year Boobs Festival! It can be remodeled into a Holstein that produces milk by being seeded! (LOL)

  • amateur uncensoredfc2
    • 2021-02-06
    21 min

    C0930 ki210206 piddle 20years old

  • amateur uncensoredc0930
    • 2021-02-09
    95 min

    241GAREA-496 Arisa

  • amateur censoredcreampiebig titsgareagarea-496garea496241garea-496
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    145 min

    [ZMEN-078]My Cousin Came To Stay Over, And She Was So Cute The Next Morning, She Was Wearing My Dress Shirt Without Her Bra On! 2

  • himari kinoshita himari hanazawa honoka wakamiya censoredblowjobZMENz mennabeZMEN-078ZMEN078h-1371zmen00078
    • 2021-02-20
    45 min

    FC2PPV 1694654 [Individual shooting] Emergency contact from the beautiful captain of the volleyball club! Help me run out of money! The finest J system and raw paco vaginal cum shot prepared for pregnancy

  • amateur uncensoredfc2
    • 2021-02-22
    120 min

    [BLOR-164]A Super Fucked-Up G-Girl After Playing The Stripping Game, She Went Cum Crazy, Drooling And Squirting Like A Horny Bitch!

  • censoredmature womanBLORbroccoli mousouzokubroccoliBLOR-164BLOR164blor00164
    • 2021-02-23
    37 min

    FC2PPV 1698252 [Personal shooting] ♀294 Female college student Ma ◯ -chan 18 years old 2nd time J-cup back dirt girls with tens of thousands of followers completely fell into a middle-aged old man’s conceived sex-treated meat urinal!

  • amateur uncensoredfc2
    • 2021-02-23
    133 min

    [STARS-329]Shared Room NTR After Filming This Elder Sister Type Weather Girl Was Unable To Get Back To Tokyo After Being Caught In A Snowstorm, So She Spent The Entire Night With The Fresh Face Assistant Director Who Always Listens To Her Bitch About

  • mahiro yui censoredcreampiesingle workSTARSsod createbungo maedasod starSTARS-329STARS3291stars00329
    • 2021-02-26
    239 min

    [SIM-111]This Real-Life Sch**lgirl Is Giving You A Slick And Slippery Lotion-Lathered Soapland Experience! First, She'll Give You Some Squishy And Sexy Pussy Grinding Action, But Then, Is That Your Cock, Slipping In Raw Into Her Pussy!？ Use Your

  • censoredcreampieuniformSIMprestigeshirotomanmanSIM-111SIM111118sim00111
    • 2021-03-05
    164 min

    [PLY-004]During Her S*****t Days She Won The Local Marathon Race - Hardcore Fucking With A Muscular And Athletic Beauty - Saki Konno/Natsuki Nagahara

  • konno saki nagatsuki natsuki censoredcosplayPLYplay entertainmentplayPLY-004PLY004h-1557ply00004
    • 2021-03-21
    161 min

    [CAWD-200]"I'm Bisexual" Mikako Horiuchi Comes Out! She's A Newcomer But She Selected Nene Tanaka As Her Partner! Completely Uned! No Stuff ! Just The Two Of Them, Doing Whatever They Like! Private Sex Between Sweet Lesbian Sluts

  • nene tanaka mikako horiuchi censoredlesbianCAWDkawaiiCAWD-200CAWD200cawd00200
    • 2021-03-26
    58 min

    383REIW-050 Natsume

  • amateur censoredbig titsamateurreiwreiw-050reiw050383reiw-050
    • 2021-03-29
    61 min

    491TKWA-073 Cute minimum system developing girl and couple play

  • amateur censoredbig titsuniformtkwatkwa-073tkwa073491tkwa-073
    • 2021-04-14
    151 min

    Caribbeancom 041421-001 Female Teacher Anthology Eri Hosaka, Tomomi Motozawa, Yui Hatano, Yayoi, Maho Sawai

  • eri hosaka uncensoredcreampiehandjobcaribbeancom
    • 2021-05-02
    135 min

    [URKK-039]You'll Cum At Least 10 Times! Big Titty Aphrodisiac Massage Where The Girls Cum And Shake Their Huge Tits While They Let You Fill Them With As Many Loads As You Want Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsURKKunfinishedwild sevena familiar breastURKK-039URKK039urkk00039
    • 2021-06-05
    128 min

    [MKON-054]But I Liked Her First ... I Was Working A Part-Time Job With This Girl, And One Night, She Did A Shift With This Horny Bastard, And The Next Morning, I Discovered A Massive Pile Of Used Condoms In The Trash Can Asuka Momose

  • momose asuka censoredcreampieschoolgirlMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-054MKON054mkon00054
    • 2021-06-08
    61 min

    499NDH-022 Is The Idol Beautiful Girl JD Who Has A Fan Club banned From Love？ Only the body is OK! Inevitable love with a naive and innocent smile! The virgin juice that has been accumulated for more than 20 years is fascinated by the soft white ass!

  • amateur censoredcreampieamateurndhndh-022ndh022499ndh-022
    • 2021-06-11
    165 min

    [EBOD-833]"I'm Not Good At Schoolwork, But I'm A Master At Sucking Dick!" She's Dumb As A Rock! But She's Gives An Incredible Blowjob! What's Wrong With That!？ This Big Tits Licking Gal Is Making Her Adult Video Debut, Y

  • miku kurusu censoredbig titsblowjobEBODe bodytrendy yamaguchiEBOD-833EBOD833ebod00833
    • 2021-06-13
    30 min

    FC2PPV 1867466 [Addition! Youth orgy] 2nd grade ♂♀ 4 people, adolescent bunny with continuous vaginal cum shot! Complete bitch of dick madness! I’m looking forward to the future w [I’m looking forward to the future]

  • amateur uncensoredfc2
    • 2021-06-20
    135 min

    [OPPW-097]French Kiss SOAP Sora Shinohara

  • sora shinohara censoredanalsingle workOPPWopenipeni world mousouzokuhimu lockOPPW-097OPPW097oppw00097
    • 2021-06-20
    240 min

    [TKBN-027]Picking Up Exposed Neighbors Barely Wearing Any Clothing 9 Girls 9 Fucks 240 Minutes

  • censoredcreampieamateurTKBNstar paradisetreasure shipTKBN-027TKBN027h-254tkbn00027
    • 2021-07-18
    126 min

    [NSFS-011]The Working Wife: Frolic And Detour On A Business Trip. Rin Kira.

  • kira rin censoredsingle workdramaNSFSnagae stylejotaro tomiNSFS-011NSFS011nsfs00011
    • 2021-07-22
    21 min

    HEYZO 2573 Erotic Massage for Amina – Amina Minami

  • amina minami uncensoredblowjobhandjobheyzo
    • 2021-08-09
    69 min

    FC2PPV 1974766 500 Yen! [4k Video] A Sweet-Hearted Loli Girl With Rounded Various Places (Boobs, Ass, Puniman) ♪ Muchimuchi Mini Loli Big Breasts (148 Cm G Cup) 18 Years Old Jd1 Saori-Chan Chapter 1 _ Main Story

  • amateur uncensoredfc2
    • 2021-08-18
    84 min

    [ZOZO-075]A Physical Examination By An Immoral Health Care Provider Who Goes After High S*********ls - The Airi Edition -

  • censoredcreampiebig titsZOZOsadie willenauZOZO-075ZOZO0751zozo00075
    • 2021-09-03
    110 min

    [ADN-341]I Fucked My Wife, Who Hates Me, While Being Obsessed With My Partner In Infidelity. Tsumugi Akari

  • akari tsumugi censoredbeautiful girlsingle workADNattackersmaeda bungouotona no dramaADN-341ADN341adn00341
    • 2021-09-23
    102 min

    [KAAD-057]Our Family"s Beautiful Mother-In-Law, Saeko Ikegami

  • saeko ikegami censoredcreampiemarried womanKAADcenter villagekotaro misatohanazono center villageKAAD-057KAAD057h-086kaad00057
    • 2021-09-24
    36 min

    FC2PPV 2241687 980 Yen! [Exclusive Video Without 4k] 3 Consecutive 4P Vaginal Cum Shot! Fair-Skinned Plump H Cup Huge Breasts Ol Chihiro-Chan Chapter 21 _ Bonus

  • amateur uncensoredfc2
    • 2021-10-09
    40 min

    FC2PPV 2319991 Infiltrate A Secret Orgy ㊳ A Cool Beauty Beauty With Sharpness ♥ S A Lot Of Characters And Ossans Are Also Tajitaji W Finally, Masturbation Instructions In Front Of You ♪ * High Quality Version & Review Benefits Included ♥

  • amateur uncensoredfc2
    • 2021-10-22
    178 min

    [HMN-065]This Real-Life College Girl Was Working Remotely And Bored Out Of Her Mind, And On The Day We Met, We Spent The Entire Day Fucking Our Brains Out At A Hotel, In Her First Creampie Fuck Mio Mashiro

  • mio mashiro censoredcreampieblowjobHMNhonnakausapyonHMN-065HMN065hmn00065
    • 2021-10-28
    190 min

    [BGN-069]新人 プレステージ専属デビュー 流川夕 この美貌に死角なし！【MGSだけのおまけ映像付き 15分】

  • amateur censoredamateurbgnbgn-069bgn069bgn-069
    • 2021-11-01
    122 min

    [AMBI-143]Three Days With Unrelated Sister-in-law! Had Continuous Sex Saying "Touch Here!!" Miina Konno

  • miina konno censoredcreampiebig titsAMBIplanet plusdirector oanbibarentsuAMBI-143AMBI143h-237ambi00143
    • 2021-11-18
    78 min

    [BGSD-418]Hidden Beauties Revolution. Ema Ichikawa

  • ai ichikawa censoredsingle workBGSDbaguschikara sawamuraBGSD-418BGSD418h-305bgsd00418
    • 2021-11-18
    105 min

    [XMOM-037]A Voluptuous Lively And Gorgeous Married Woman Sex That Feels So Good This Captivating Married Women Will Cry Chisato Shoda

  • shota chisato censoredmarried womanmature womanXMOMcenter villagesky cloudspink breathXMOM-037XMOM037h-086xmom00037
    • 2021-12-09
    27 min

    FC2PPV 2503951 Until Tomorrow, "# 16" Slender Hairdresser. She Praised The Otaku Oji As "Kimoine ♡". Fucked And Vaginal Cum Shot ♡ There Is Comfort ♡

  • amateur uncensoredfc2
    • 2021-12-10
    181 min

    [IPIT-022]I Just Wanted To Squirt... Av Debut Of A Beautiful Girl With Beautiful Snow-white Skin Who Blows Too Much! Mei Uesaka

  • mei uesaka censoredsquirtingblowjobIPITidea pocketusa pyonideapocket talent discovery projectIPIT-022IPIT022ipit00022
    • 2021-12-20
    64 min

    SIRO-4689 [First Shot] [Baby Face Slender] [Hidden Masochism] Excavation Of A Necafe Clerk Who Convulsions A Delicate Sensitive Body And Dies. When The Face Of A Young Girl Transforms Into A Lewd Female Facial Expression And The Foolery Is Revealed .

  • amateur censoredamateursirosiro-4689siro4689siro-4689
    • 2022-01-08
    123 min

    [MKMP-434]I Found A Slut On A Dating App Who Looks Like She Loves Fucking, Starring Sarina Momonaga

  • sarina momonaga censoredbig titsslutMKMPk m producejohnny shibuyamillionMKMP-434MKMP434mkmp00434
    • 2022-01-21
    88 min

    [MBDD-2065]Shoko Takahashi / Venus"s Offensive Joke

  • shoko takahashi censoredbig titsbeautiful girlMBDDmedia brandMBDD-2065MBDD2065301mbdd02065
    • 2022-01-28
    92 min

    573DHT-0357 [Yariman Smell Plump Girls] Amazing Technique! [Rolling Semen With A Long Tongue] A Magician With A Tongue! [Natural Soft Milk J Cup] Marshmallow Fucking! [Don’t Let Go If You Suck] Suppon Blow! I Really Like It! Zukkin! Zukkin! Real

  • amateur censoredcreampiebig titsdhtdht-0357dht0357573dht-0357
    • 2022-01-29
    169 min

    [SORA-360]The Absolute Sperm D***king Principle A Highly Educated JD Who Passed The National Exam With Flying Colors And Was Released From Her Abstinent Lifestyle, Took 10 Shots Of Sperm With 3 Years Worth Of Sexual Desire! Mao Watanabe

  • mao watanabe censoredblowjobsingle workSORAyama to sorahimurokkuSORA-360SORA360sora00360



    • Jav Cherry, watch JAV streaming online japanese xxx