big tits cock high vision censored jav




FC2NGODDTTHODVNNPJMARAAUKGROYDHDKANACRRBDBBANJULHMNSQTEADNWAAANATRMILKGVHMVSD

2020-10-25
31 min

279UTSU-460 Honokasan

  • amateur censoredcreampiemarried womanutsuutsu-460utsu460279utsu-460
    • 2020-11-06
    119 min

    [JUL-368]"Hey？ Are You Really A Cherry Boy？" - A Married Woman Who Continued To Fall For This Cherry Boy Scam - Rumi Mochizuki

  • rumi mochizuki censoredmature womansingle workJULmadonnajotaro tomiJUL-368JUL368jul00368
    • 2020-11-12
    137 min

    [FONE-123](Amateur Video / Must-See Film) A Super Small Tits, No-Bra Cute Lolita Running Away From Home Who I Met On The Internet That Cums Like Crazy From Her Nipples Stays Over At My House (Tentative)

  • censoredcreampieamateurFONEfirst starplus first starFONE-123FONE123h-491fone00123
    • 2020-11-20
    240 min

    [MBM-241]mpo.jp Presents The *Nonfiction Picking Up Amateur Girls, Ultimate Best [Street Corner Girls' Super Juicy Cumming Edition] 12 People, 4 Hours

  • censoredsquirtingamateurMBMprestigempo selection.committeembmMBM-241MBM241118mbm00241
    • 2020-12-24
    235 min

    [PIYO-099]She Only Offered Her Body In Order To Protect Her Loved Ones... But Now This Whale Of A Y********l Is Squirting Like A Horny Bitch And Excessively Cumming Like A Whore

  • censoredsquirtingschoolgirlPIYOhyokopiero dagrey wolfPIYO-099PIYO0991piyo00099
    • 2020-12-25
    53 min

    [ETQR-183](Daydream POV) Receptionist Who Wants To Get Ravished AOI Aoi Nakajo

  • nakagusuku censoredcreampieuniformETQRerotic timeETQR-183ETQR183h-1186etqr00183
    • 2021-01-01
    76 min

    345SIMM-587 The school’s number one diva wants to pant (sing) only to her uncle! Ma-ji-de-cute unfussy beautiful girl J ○ holds Ji-ko instead of a microphone and sings a big sweet Kyun SEX on the bed! !! !! “(If you win the game) Eat your u

  • amateur censoreduniformschoolgirlsimmsimm-587simm587345simm-587
    • 2021-01-07
    244 min

    [FZR-066]Hot Slender Married Woman's Impregnation Awakening - Bred With A Creampie Through Cheating Sex 240 Minutes

  • censoredcreampiemarried womanFZRhamedori.network secondeditionFZR-066FZR0663fzr00066
    • 2021-01-07
    19 min

    FC2PPV 1635569 1800pt → 900pt [Gonzo] A married woman who is in an affair is blamed for denma at a remote hotel and rich SEX

  • amateur uncensoredfc2
    • 2021-01-20
    120 min

    [GVH-184]She Doesn't Want To Waste Any Semen, So She'll Lick It All Down For A Cum Swallowing Good Time! This Semen-Saver Mama Is Not Wasting Any Tissues And Helping Out The Environment Yuri Sasahara

  • yuri sasahara censoredslutmomGVHglory questkabin kizakuraGVH-184GVH18413gvh00184
    • 2021-02-01
    120 min

    [NACR-396]Vestiges Of His Father: Widow Seduces Her Stepson Shoko Tokuyama

  • shoko tokuyama censoredblowjobmature womanNACRplanet plusbito sakurananakuruNACR-396NACR396h-237nacr00396
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-19
    65 min

    499NDH-001 A remote control vibrator is put in the delivery girl who devours the customer and the customer is convex! Squirting acme that makes a tight body cramp! “I want to insert it forever ♪” 2 consecutive vaginal cum shot SEX! [Deliver

  • amateur censoredcreampieamateurndhndh-001ndh001499ndh-001
    • 2021-02-20
    120 min

    [DMAT-190]A Stepmom Gets A Night Visit

  • marie yoshino shoko furukawa censoredcreampieblowjobDMATstar paradisemoku tenDMAT-190DMAT190h-254dmat00190
    • 2021-03-08
    78 min

    300MIUM-689 Tan gal wife! !! !! [Erection is inevitable in the sunburn marks that shine in the slender BODY] × [The body that has been fully developed seeks a penis and estrus MAX! ] × [Overwhelming pie pressure! Exquisite fucking pinch! !! ] Looks,

  • amateur censoredcreampiebig titsmiummium-689mium689300mium-689
    • 2021-03-18
    58 min

    Pacopacomama 031821_448 Fucking While Calling Hubby: Hentai wife hungry for sex Mikako Tachibana

  • amateur uncensoredpacopacomama
    • 2021-03-23
    61 min

    1Pondo 032321_001 Seducing by Flashing Pussy: Mikako Tachibana

  • amateur uncensored1pondo
    • 2021-04-02
    120 min

    [JUL-521]Natural + Mysterious Sweet Soft Married Woman Looks Like An Adult But Has A Pure Heart Rima Suzukawa 32 Years Old Porn Debut!

  • rima suzukawa censoredmature womansingle workJULmadonnamametaro mamezawaJUL-521JUL521jul00521
    • 2021-04-16
    72 min

    328HMDN-354 [Individual] 43-year-old G-Cup Health Teacher Treating a too obscene body like a toy and seeding

  • amateur censoredcreampiebig titshmdnhmdn-354hmdn354328hmdn-354
    • 2021-04-18
    163 min

    [DGCEMD-002]- Streaming Only! With Special Footage - I Bought A Sex Doll That Does What I Want Hikari Sena

  • hikari sena censoredbig titsmature womanDGCEMDcelebrity friendsDGCEMD-002DGCEMD002dgcemd00002
    • 2021-04-23
    157 min

    [WAAA-058]The Condom Broke But She Let Me Fuck Her Anyway! High-Speed Raw Fucking And Creampie After Creampie! Mei Satsuki

  • satsuki mei censoredcreampiebig titsWAAAwanz factorywanzWAAA-058WAAA058waaa00058
    • 2021-05-21
    57 min

    FC2PPV 1828768 [No] [Complete appearance] 21-year-old Miki-chan, Faculty of Economics, pregnant with a sober gamer working at a ramen shop Unauthorized vaginal cum shot [* Blow (mouth ejaculation) & undressing / shower hidden shooting benefits ava

  • amateur uncensoredfc2
    • 2021-06-05
    123 min

    [PKPD-145]Amateur Fuck Buddy Documentary - Lightly Buzzed Creampie Sex With Fragrant Pretty Office Lady In Pantyhose - Hana Shirato

  • white peach censoredcreampiesingle workPKPDfuck group and fun friends daydreamersPKPD-145PKPD145pkpd00145
    • 2021-06-10
    119 min

    [HBAD-585]A Mother Was Made To Have Sex With Her Son's Friends To Relieve Their Sexual Desire And Ended Up Being Covered In Semen Ayano Fuji

  • ayano kato censoredmomsingle workHBADhibinodragon nishikawababeHBAD-585HBAD5851hbad00585
    • 2021-06-19
    180 min

    [JUL-611]No: A Beautiful Woman With Thorns Yes: A Married Woman With Gaps - Sakuraka Mizuki 28 Years Old AV Debut!!

  • sakuraka mizuki censoredmarried womanmature womanJULmadonnakannana dynanaJUL-611JUL611jul00611
    • 2021-06-29
    124 min

    [SAN-008]The Prostitution Interview Document Of a Polite Girl Tricked By A Akutoku Tencho - Nozomi Higashi

  • nozomi higashi censoredsingle workSANmothermother motherSAN-008SAN008h-796san00008
    • 2021-07-17
    179 min

    [JUL-655]Temptation of a Mother in Law who Wants her Son in Law's Dick so Much She Can't Stand It Asahi Mizuno

  • mizuno chaoyang censoredmature womanslutJULmadonnakogoro kindaichiJUL-655JUL655jul00655
    • 2021-08-12
    89 min

    FC2PPV 1997920 Mayu-Chan, An 18-Year-Old Flower Arrangement Club Aiming For Ca. She Has A Petite, Fair Body, She Still Doesn’T Know Her Filth. The Whole Story Of The Elite Highway Being Deceived And Tossed, And Her Mind And Body Being Tossed.

  • amateur uncensoredfc2
    • 2021-08-17
    151 min

    [SDAB-194]The Famous Girl From The Bathhouse That Helps You Wash Your Back And Deal With Your Sex Drive.

  • sakita ran takayama suzu censoredsquirtingbeautiful girlSDABsod createdazai chinposeishun jidaiSDAB-194SDAB194
    • 2021-08-24
    53 min

    C0930 ki210824 Maeko Watarai 45years old

  • amateur uncensoredc0930
    • 2021-08-30
    46 min

    FC2PPV 2106128 [No] A Beautiful Woman! A Certain 〇〇 Model F Cup! Unauthorized Vaginal Cum Shot From Guarantee Drinking! [Cowgirl] [Back] [Missionary] [Before Deleting]

  • amateur uncensoredfc2
    • 2021-09-01
    120 min

    [NACR-455]A Female Editor Kept As A Pet By An Older Novelist - Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiesingle workNACRplanet plussakura ninshichi ku ryuuNACR-455NACR455h-237nacr00455
    • 2021-09-03
    117 min

    [NNPJ-470]I Wanted To Get A Quick Clean Fuck So I Got My Hands On A Pay-For-Play Gal In A Miniskirt And Seduced Her! I Immediately Took Her Home And Immediately Creampie Fucked Her In The Raw! And Then I Immediately Threw Her Out! But Then ... She Be

  • censoredcreampieuniformNNPJnampa japanNNPJ-470NNPJ470nnpj00470
    • 2021-09-18
    62 min

    519MAZOF-016 [Jueju] Receptionist 27 Years Old [Beautiful Slut] Cum Shot In 1 Hour Of Break "There Is No Company Anymore" Uterus Hihi Pleasure Acme Convulsions I Can Not Stop, So I Will Attack The Big Cock Piston Steadily

  • amateur censoredcreampieamateurmazofmazof-016mazof016519mazof-016
    • 2021-09-20
    97 min

    [SPZ-1114]Surprisingly Easy To Seduce! Older Masseuse At A Business Hotel 2

  • censoredamateurmature womanSPZstar paradisesuta paradaisuSPZ-1114SPZ1114h-254spz01114
    • 2021-09-25
    120 min

    [KAGP-196]I Will Wash Your Cock 4: 9 Amateurs" Part-time Job

  • censoredamateurblowjobKAGPkaguya hime pt mousozokutsumatori no okinakaguya hime ptKAGP-196KAGP196kagp00196
    • 2021-10-16
    146 min

    [MYBA-039]Married Woman Petal Turning Aizuki Celia

  • aitsuki celia censoredbig titsmature womanMYBAhitodzumaengokai emanuelkiiroi hyouMYBA-039MYBA039myba00039
    • 2021-10-29
    72 min

    523DHT-0308 Asian Plump Nasty E Cup Big Tits Wife Yuri 41 Years Old (Yuri Tadokoro)

  • amateur censoredcreampiebig titsdhtdht-0308dht0308523dht-0308
    • 2021-10-30
    135 min

    [GVH-309]The Sexy President of the PTA and the S*****t Council Brats. Miki Mori

  • miki mori censoredcreampiesingle workGVHglory questhyonGVH-309GVH309gvh00309
    • 2021-11-06
    72 min

    355OPCYN-195 Mai 2 (Kaho Imai)

  • amateur censoredcreampiebig titsopcynopcyn-195opcyn195355opcyn-195
    • 2021-11-06
    58 min

    [HEYZO-2652]Nana Kamiyama Cuckold"s Fiancee !-My Colleagues Betrayed Me-

  • nana kamiyama uncensoredcreampieheyzo
    • 2021-11-08
    107 min

    300MIUM-769 Everything Is Cute And Sloppy Ww Face, Body, Voice And Gestures Are Good And It’s A Beautiful Girl Who Is Too Addictive And Echoes! !! But My Boyfriend Hasn’t Been There For 5 Years! !! Too Good To Waste! !! !! Tonight’s Bi

  • amateur censoredcreampiesquirtingmiummium-769mium769300mium-769
    • 2021-11-13
    175 min

    [TNOZ-009]105 cm Colossal Tits TSUNDERE Beautiful Girl Leia, 19 "Full Body Erogenous Zone Orgasm Just From Nipples" "Overflowing Saliva French Kiss & Face-Fucking Ejaculation & Pee D***king..."

  • censoredbig titscosplayTNOZall japan amateur photographers union daydream fantasy loversspit uncle 2 all japan kameko cooperative daydream tribeTNOZ-009TNOZ009tnoz00009
    • 2021-12-09
    130 min

    [MEKO-220]"Milf Rentals" Service Returns 08. Asked For A Secret Creampie While Fucking This Lewd And Gentle Mature Woman. Now I Want To Come Back To Her For Even More Amazing Sex.

  • censoredcreampieamateurMEKOjukujo laboMEKO-220MEKO220h-1160meko00220
    • 2021-12-17
    237 min

    [MUKD-469]Rub Your Dick Between the Thighs and Against the Ass of Barely Legals, who are Dressed in School Swimsuits. They"ll Service You with Blowjobs. Completely New Content on Film. 10 Women, 4 Hours.

  • riko shinohara miu susaki censoredschoolgirlblowjobMUKDmukuMUKD-469MUKD469mukd00469
    • 2021-12-24
    136 min

    [JUL-813]Haughty Female Boss Who Replaced Her Husband Answers Embarrassing Complaints. Married Woman Gives Apology While Vibrator Is On Her Pussy. Maiko Ayase

  • maiko ayase maria sawaguchi censoredmature womansingle workJULmadonnarokusaburo mishimaJUL-813JUL813jul00813
    • 2022-01-03
    88 min

    FC2PPV 2567724 ☆ First Shot ☆ Complete Appearance ☆ 148cm Small Loli Body ♥ Plenty Of Vaginal Cum Shot In A Baby-Faced Beautiful Girl’s Kitsman ♥ [Personal Shooting]

  • amateur uncensoredfc2
    • 2022-01-07
    60 min

    329EXMU-075 Rina-chan (Rina Takase)

  • amateur censoredcreampieschoolgirlexmuexmu-075exmu075exmu-075
    • 2022-01-07
    129 min

    [NGOD-165]The Janitor, Who Is A Wife With Colossal Tits, Gets Fucked By Another Guy. Cleaning Up A Building While Having Embarrassing Sex With Another Guy. Hana Haruna

  • haruna hana censoredmature womansingle workNGODjet eizomanji groupNGOD-165NGOD165ngod00165
    • 2022-01-28
    137 min

    [SHKD-987]Orgy Planning. The Beautiful Receptionist Edition. Minami Hatsukawa

  • hatsukawa minami censoredsingle workSHKDattackerssharkSHKD-987SHKD987shkd00987
    • 2022-01-28
    162 min

    [WAAA-140]Erotic Tongue Trance! Helpless Men Are Left In A Daze From Cumming! Starring Riho Fujimori

  • riho fujimori censoredcreampieslutWAAAwanz factorywanzWAAA-140WAAA140waaa00140
    • 2022-01-28
    119 min

    [ATID-498]女教師 恥辱のアナル輪● 竹内夏希

  • natsuki takeuchi censoredanalsingle workATIDattackersnavein madATID-498ATID498atid00498
    • 2022-01-31
    63 min

    SIRO-4765 [First Shot] [Obvious Plump Body] [Shaking Obscene G Milk] Gap From The Interview ○, A College Student With A Plump Body Appeared. While Saying That It Is For Money, If A Cock Is Inserted, It Will Reach The Climax Many Times With A Reaction

  • amateur censoredbig titsamateursirosiro-4765siro4765siro-4765
    • 2022-02-05
    125 min

    [GMA-028]Bondage Wife: A Virtuous Wife Learns The Pleasure Of Being Tied Up To Make Up For Her Husband"s Accident Starring Nanako Takamiya

  • nanako takamiya censoredmature womanbdsmGMAglobal media annexkaiGMA-028GMA028gma00028
    • 2022-02-06
    44 min

    [HEYZO-2713]Misaki Aki Sex Spree With Horny FWB

  • misaki aki uncensoredcreampieheyzo
    • 2022-02-10
    200 min

    [PIYO-138]Hyoko Domestication Collection Vol. 1. Hot Plays With Cum. That Load Goes In And Drips Out Too, Cum Swallowing Together Is Appreciated As Well.

  • censoredcreampiesquirtingPIYOhyokopiero daPIYO-138PIYO1381piyo00138



    • Jav Cherry, watch JAV streaming online japanese xxx