big tit butt high visio jav javcensored




FC2VEMAATIDGVHROYDNGODABWFSDSSAWDAVSANACRHDKAMEYDSQTEAPODWANZRBDMIDVHNDHZGDAUKS

2021-01-09
31 min

279UTSU-482 Mai!

  • amateur censoredcreampiebig titsutsuutsu-482utsu482279utsu-482
    • 2021-01-16
    74 min

    [MBF-005](A FANZA Exclusive) (For Streaming Editions) The Charlatan Couple - A Deceptive Woman And A Deceived Woman - Hibiki Otsuki Yui Hatano Chapter 2 A Perverted Couple Who Deceived My Neighbors And Fucked Them Both

  • otsuki sound yui hatano censoredcreampiebig titsMBFmax ak c takedaMBF-005MBF005mbf00005
    • 2021-02-04
    150 min

    [NITR-505]Pervert`s Hunt For Married Woman With Big Tits VII Nene Tanaka

  • nene tanaka censoredcreampiebig titsNITRcrystal eizoharuo miyafujinitroNITR-505NITR50549nitr00505
    • 2021-02-05
    80 min

    FC2PPV 1668094 [Uncensored] ★ Naughty ★ After giving a massage, I got a blowjob in the open-air bath …!？ “Personal shooting”

  • amateur uncensoredfc2
    • 2021-02-05
    243 min

    [HEZ-252]Hot Babes With Wild Booty - 12 Girls With Top-Grade Asses

  • censoredbig titsHEZhot entertainmentcompany matsuoHEZ-252HEZ25259hez00252
    • 2021-02-06
    170 min

    [JUL-455]She Might Look Proper, But She's A Secret Sex Fiend Who Gets Off Five Times In One Day And Still Isn't Satisfied - Sakura Miyazono, Age 30, Her Porn Debut!

  • saki miyazono censoredmature womansingle workJULmadonnamametaro mamezawaJUL-455JUL455jul00455
    • 2021-02-12
    158 min

    [MIDE-886]Sweet, Beautiful Girl With An Adorable Accent Takes On Her First Client At A Soapland Brothel Nozomi Ishihara

  • ishihara hope censoredcreampiebig titsMIDEmoodyzhirokoji osakimoodyz divaMIDE-886MIDE886mide00886
    • 2021-02-12
    148 min

    [MKMP-380]I Moved Into This New Apartment, And The Married Woman Next Door Would Cum To My Front Door And Fuck With Me, And There Were 2 Of Them, And Every Day, They Would Both Lure Me To Temptation So Much That My Dick Never Had Time To Dry And So,

  • natsuho imai misuzu kawana censoredbig titsslutMKMPk m producegory matsutamillionMKMP-380MKMP38084mkmp00380
    • 2021-02-19
    118 min

    [MRSC-008]"What Are You Planning To Do By Stealing An Old Lady's Underwear ... ？" 3 This Married Woman Was Being Neglected By Her Husband, So When She Got Her Panties Stolen, That Got Her Hot And Horny! 10 Ladies, All In Exclusively Filme

  • censoredcreampieblowjobMRSCmisesu no sugao emmanuelleokina tsumadorinomisses amateur faceMRSC-008MRSC008mrsc00008
    • 2021-02-20
    131 min

    [COD-003]When She Asked Him, "What Part Of Me Do You Like Best？" He Immediately Answered, "Your Pussy," And Now, Every Morning, She Wakes Up To Cunnilingus In A Pussy-Licking Life Together Mahiro Ichiki

  • mahiro ichiki censoredbeautiful girlsingle workCODdream ticketkogoro kindaichiCOD-003COD00324cod00003
    • 2021-02-26
    28 min

    359TYVM-134 Mizuho

  • amateur censoredbig titsamateurtyvmtyvm-134tyvm134tyvm-134
    • 2021-02-27
    55 min

    H0930 tk0029 Ryoko Chidimatsu 36years old

  • amateur uncensoredh0930
    • 2021-03-06
    119 min

    [SSIS-011]Seduction - She Never Wears Her Bra, And You Can See Her Cleavage (Completely Clothed) J-Cup Babe Aka Asuka

  • arisu aka censoredbig titssingle workSSISs1 no 1 stylekyoseiSSIS-011SSIS011ssis00011
    • 2021-03-06
    96 min

    [SHKD-933]An Intellectual Professor Turned Pervert And A Beautiful Literary Girl: Record Of A Sexual Desire Processing Tow - Uta Yumemite

  • yumemi teruuta censoredbeautiful girlsingle workSHKDattackersnavesharkSHKD-933SHKD933shkd00933
    • 2021-03-07
    136 min

    [TSF-015]You're A Male Office Worker, But When You Wake Up In The Morning, You've Discovered That You've Become A Woman (20) A Thorough Investigation You Were Bi And Absolutely The Dominant One, But Now You're Cumming Like A Bitch And

  • ao itaba censoredcreampiebeautiful girlTSFkaguyahimept mousouzokugynecomastia reportTSF-015TSF015tsf00015
    • 2021-03-12
    47 min

    FC2PPV 1686765 First shot ❤️ Former reader model Shiori Ito 26 years old ❤️ There is a purchase privilege with two singles recruited on Twitter and a nasty orgy

  • amateur uncensoredfc2
    • 2021-03-13
    146 min

    [JUFE-265]What Is Wrong With Cunnig Huge Tits？ Fucking Her Sister`s Boyfriend On the Weekend! Rena Momozono

  • reina taoyuan censoredcreampiebig titsJUFEfitchJUFE-265JUFE265jufe00265
    • 2021-03-14
    73 min

    428SUKE-064 [Half Gal x Dance x Sex] Only the black gal won! !! Filipino half pie bread dancer appeared! Trained belly circumference! The waist is erotic! Sex dance regardless of sofa, stairs, location ☆ Party held www [NO.5 Sara]

  • amateur censoredcreampiebig titssukesuke-064suke064428suke-064
    • 2021-03-19
    117 min

    [DDOB-089]Masochist Nursing Mother Cums While Shooting Milk From Her Tips Hinami Narusawa

  • hinami narusawa censoredmature womansingle workDDOBdogmatenunmy auntDDOB-089DDOB089ddob00089
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-04-28
    79 min

    259LUXU-1375 Luxury TV 1397 Slender busty half-faced idols make their long-awaited AV first appearance. Dense sex that gets drunk with the technique of an actor while shaking the soft big tits that captivate men in the world!

  • amateur censoredbig titsamateurluxuluxu-1375luxu1375259luxu-1375
    • 2021-05-07
    119 min

    [MEYD-675]I Went To A Rubber Mat Health Club That Didn't Allow Fucking, And Out Came The Haughty And Naughty Beautiful Married Woman From Next Door. Now That I Knew Her Secret, I Could Get All The Sex And Creampie Fucking I Wanted! And Even Outsi

  • hikari hime censoredcreampiesingle workMEYDtameike goroshiro shotenMEYD-675MEYD675meyd00675
    • 2021-05-08
    149 min

    [USAG-028]"Just Your Kiss Is Getting Me Wet." I-Cup Amateur Girls - Colossal Tits / Chubby / Petite / Rural / Blowjob Lover / Creampie Sex

  • censoredcreampiebig titsUSAGrabbit daydreamersUSAG-028USAG028usag00028
    • 2021-06-18
    72 min

    383REIW-074 Yuno

  • amateur censoredcreampieamateurreiwreiw-074reiw074383reiw-074
    • 2021-06-19
    115 min

    [CAWD-229]S********l In Uniform Bred By 48 Raw Loads By A Smelly Older Man In Her Neighbor's Garbage-Strewn Room... Yumeru Kotoishi

  • yume kotoishi censoredcreampieuniformCAWDkawaiiCAWD-229CAWD229cawd00229
    • 2021-06-25
    179 min

    [MIAA-459]Super High Class Creampie Specialty Soapland Lily Hart

  • lily heart censoredcreampiebig titsMIAAmoodyzzaku araieveryone s porn starMIAA-459MIAA459miaa00459
    • 2021-06-26
    241 min

    [SGSR-281]Nonfiction - Real Peeping Voyeur Footage Of Private Sexual Encounters Leaked Online 15 Girls Complete Edition 02

  • censoredbig titsSGSRbig morkaleigyochuushinsengumiSGSR-281SGSR28157sgsr00281
    • 2021-06-26
    82 min

    200GANA-2514 Seriously Nampa, first shot. 1653 A beautiful salon model who continues to pass by her boyfriend! If you stimulate the sexual desire that can not be released by masturbation … The erotic cute nature that screams with a sweet voice!

  • amateur censoredamateurganagana-2514gana2514200gana-2514
    • 2021-07-05
    65 min

    FC2PPV 1903312 [Personal shooting] ♀ 314 Miss Kyaba ◯ Ri-chan 19 years old 1st time A single first shot debut of pregnancy preparedness where a baby-faced Lori beautiful girl is baptized with a large amount of super-rich semen!

  • amateur uncensoredfc2
    • 2021-07-10
    107 min

    [APNS-248]Fiancee Disappears and is Fucked Hard in a Circle Orgy and DVD is Sent to Husband. Rin Miyazaki

  • miyazaki rin censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-248APNS248apns00248
    • 2021-07-17
    147 min

    [CAWD-253]"You Nervous？ But I Bet You Still Wanna Fuck？" Thrilling Reverse Threesome with Two Girls in School Uniform Teaming Up on One Lucky Guy.

  • ito meru hinano tachibana censoredcreampieuniformCAWDkawaiisapporo taroCAWD-253CAWD253cawd00253
    • 2021-07-23
    121 min

    [XVSR-607]The Married Woman Makes A Cuckold Of Her Husband While He Is On A Business Trip - Going At It Non-Stop For 26 Hours With Her Neighbor - Hibiki Otsuki

  • otsuki sound censoredcreampiebig titsXVSRmax ak c takedacalenXVSR-607XVSR607xvsr00607
    • 2021-07-24
    151 min

    [MCSR-443]A Slutty Apartment Wives With Colossal Tits: Beautiful, Mature Women In The Neighborhood Who Are Frustrated: Two Women Who Sleep Around

  • oda mako kiriko imato censoredbig titsmature womanMCSRbig morkalmascottMCSR-443MCSR44357mcsr00443
    • 2021-07-31
    110 min

    [MEAT-034]Plump Big Butt: H103! A Quiet, Really Pervy Country Girl Who Goes To Tokyo To Date A Sugar Daddy

  • censoreduniformschoolgirlMEATbig the nikumichi mousozokuMEAT-034MEAT034meat00034
    • 2021-08-07
    240 min

    [NASH-550]Wives That Fall For Another Man"s Dick - In Front Of Their Husband

  • censoredcreampieNASHnadeshikoNASH-550NASH550nash00550
    • 2021-08-21
    61 min

    HEYZO 2595 Specially Treated By Big Tits Nympho Nurse Vol.2 – Misa Makise

  • misa makise uncensoredcreampiecumshotheyzo
    • 2021-08-26
    482 min

    [FCDSS-013]Nene Yoshitaka FALENO Exclusive First Best 8 Hours Please Look At Me Who Is Honest When Fucking

  • nine yoshitaka censoredslutFCDSSfalenofaleno starFCDSS-013FCDSS0131fcdss00013
    • 2021-09-02
    50 min

    FC2PPV 1920442 [Personal Shooting] Appearance Narumi 20 Years Old G Cup Duero Body Plump Daughter With Super Big Cock Cum Shot! !!

  • amateur uncensoredfc2
    • 2021-09-04
    136 min

    [RMER-006]118 kj Super Thick H Cup Mature Woman Porn Debut Aki Kozaka

  • aki kosaka censoredmature womansingle workRMERmare rare mousouzokushimokita kickmareRMER-006RMER006rmer00006
    • 2021-09-17
    161 min

    [BLK-522]A One-night, Two-day All-you-can-fuck Resort Tour With Horny Monster, Ayaka Mochizuki!!

  • ayaka mochizuki censoredbig titsslutBLKkira kirakira hosi kira black galBLK-522BLK522blk00522
    • 2021-09-24
    156 min

    [CJOD-313]Lewd Older Sister Turns Into A Slut For A Creampie. Rejuvenating Asian Men"s Massage Parlor. Luna Tsukino

  • tsukino luna censoredcreampieslutCJODbioosaki hirokoujichijo hebunCJOD-313CJOD313cjod00313
    • 2021-10-01
    124 min

    [ADN-347]I Indulged In Passionate Adultery And Sex With My Secretary, A Married Woman, At A Hotel During A Business Trip. Tsumugi Akari

  • akari tsumugi censoredsingle workADNattackersdoragon nishikawaotona no dramaADN-347ADN347adn00347
    • 2021-10-14
    57 min

    H4610 ki211014 Maya Bando 26years old

  • amateur uncensoredh4610
    • 2021-11-11
    94 min

    [OKB-123]Nenne Ui A Voluptuous Big Ass A Goddess In Bloomers From A Lolita Beautiful Girl, To A Married Woman (Dear Wife, Can I Fuck You？), And A Chubby Girl, We Dressed These Hot Bitches In Tight Bloomers And Gym Shorts So We Could See Their Asses A

  • first love censoredsingle workbukkakeOKBoyaji no kosatsukami bloomersOKB-123OKB1231okb00123
    • 2021-11-13
    111 min

    [JUAN-008]A MILF"s First Anal for Son in Law, Arisa Shitara

  • shitara arisa censoredcreampiemature womanJUANrubykoji tsujilust rubyJUAN-008JUAN008juan00008
    • 2021-11-16
    65 min

    285ENDX-367 A Case Where A Fair-Skinned And Chikappa-Ish Beauty Member Made 3 Vaginal Cum Shot

  • amateur censoredcreampieamateurendxendx-367endx367285endx-367
    • 2021-11-19
    160 min

    [SSIS-253]He Always Dreamed About Getting Jammed By Colossal Tits Like These ... The Man Could Not Resist A Titty Fuck Like This. This Titty Slut Could Melt His C*ck Like Butter In Her Hands Konan Koyoi

  • koyoi konan censoredbig titsblowjobSSISs1 no 1 stylegoemonSSIS-253SSIS253ssis00253
    • 2021-12-04
    138 min

    [XVSR-623]A Reincarnated Cinderella Girl A Splashy Debut Mizuki Sakino

  • mizuki sakino censoredsquirtingsingle workXVSRmax asono kancalenXVSR-623XVSR623xvsr00623
    • 2021-12-18
    51 min

    C0930 hitozuma1369 Anna Yokohatra 27years Old

  • amateur uncensoredc0930
    • 2021-12-24
    74 min

    483SGK-060 [Creampie Zammai Raw 6 Barrage] [Saddle Tide Monster] [Crazy Faucet Ma ● Ko] [Semen Covered Tide Covered] [Ikuikutsu Climax Ren] Gold Medal Gal Closing 2021! !! Blonde Short! Golden Lingerie! !! Gold Medal Winning Climax Meister! !! !! The

  • amateur censoredcreampiesquirtingsgksgk-060sgk060483sgk-060
    • 2021-12-27
    87 min

    328HMDN-439 [Individual] Brown Eloy Body Beauty Cosmetologist 45-Year-Old Raw Saddle Sex Outflow. A Married Woman (Mio Morishita) Who Is Stabbed By Another Stick Until She Falls Down On A Young Body (Saionji Mio)

  • amateur censoredcreampieamateurhmdnhmdn-439hmdn439328hmdn-439
    • 2021-12-31
    162 min

    [CAWD-331]I Was Surrounded On All Sides By These 4 Sisters, And They Subjected Me To Some Serious Slut Treatment And Gave Me A Dream-Cum-True Creampie Harem Good Time Ichika Matsumoto Asuka Momose Chiharu Sakurai Sumire Kuramoto

  • ichika matsumoto momose asuka censoredcreampiebeautiful girlCAWDkawaiirakudaCAWD-331CAWD331cawd00331
    • 2022-01-04
    46 min

    FC2PPV 2569348 [Individual Shooting 67] 21-Year-Old Neat And Clean Half-Striped Pie Bread ④ From Cosplay Continuous Vaginal Cum Shot To Cleaning Fellatio 3480pt → 1500pt

  • amateur uncensoredfc2
    • 2022-01-14
    151 min

    [BLK-551]Convoy! Giraffe Gyaru Deli One Day Experience Yu Shinoda Mio Kimishima

  • shinoda yu kimishima mio censoredcreampieblowjobBLKkira kirainaballkira kira black galBLK-551BLK551blk00551
    • 2022-01-21
    141 min

    [JUL-842]My Beloved Stepmom Who Raised Me By Herself Since I Was A C***d Was Fucked By My Terrible Friend... Marina Shiraishi

  • rena shiraishi censoredcreampiebig titsJULmadonnashiro shotenJUL-842JUL842jul00842
    • 2022-01-21
    119 min

    [JUL-839]The Second Blitz Transfer! The Long-awaited "Nakadashi" Has Been Released! After Having Sex With My Husband, My Father-in-law Always Makes Me Cum Inside Him... Rio Kuriyama

  • rio kuriyama censoredcreampiemature womanJULmadonnajotaro tomiJUL-839JUL839jul00839



    • Jav Cherry, watch JAV streaming online japanese xxx