big cock high vision amateur javcensored jav




FC2SDABHODVSANSSNIMEYDGMEMSPRDFSDSSVEMAHMNONEZMARAAUKGHDKABBANAUKGNNPJMVSDBLKWAAA

2020-09-12
55 min

C0930 hitozuma1333 Yukari Mera 26years old

  • amateur uncensoredc0930
    • 2020-09-16
    60 min

    [NTTR-051](A Possessed NTR Video) Possessing Women And All Channels! She Entered The Body Of The Girl In This Couple In A Streaming Video And Now She's Jumping On My Cock. Rika Aimi

  • rumi tadami censoredcreampiebig titsNTTRsod createinoue japantakeoverNTTR-051NTTR0511nttr00051
    • 2020-10-03
    118 min

    [SHKD-910]She Undertook An Undercover Investigation To Take Down The Evil Syndicate Which Caused Her Lover's Death, But She Ended Up Becoming One Of Their Sex Toys Rei Amakawa

  • rei amagawa censoredbig titssingle workSHKDattackersbungo maedasharkSHKD-910SHKD910shkd00910
    • 2020-10-08
    65 min

    [ore-715]りの研究員

  • amateur censoredcreampieamateuroreore-715ore715ore-715
    • 2020-10-20
    85 min

    [stst-012]とき

  • amateur censoredamateurbeautiful girlstststst-012stst012stst-012
    • 2020-10-25
    61 min

    SIRO-4314 [First shot] [Peeing immorality] [Cowgirl on top posture] A 19-year-old female college student who is super shy. Even though I was nervous and tense, I was thrust into the back that my boyfriend’s thing could not reach … AV applic

  • amateur censoredsquirtingamateursirosiro-4314siro4314siro-4314
    • 2020-10-31
    186 min

    [WAAA-001]If You Can Put Up With Rena Aoi's Terrific Technique, You Get To Give Her Raw Creampie SEX!

  • blue censoredcreampiebeautiful girlWAAAwanz factorywanzWAAA-001WAAA001waaa00001
    • 2020-11-27
    72 min

    [opcyn-121]なな(22)

  • amateur censoredsquirtingamateuropcynopcyn-121opcyn121opcyn-121
    • 2020-12-03
    486 min

    [ABBA-498]2020 Center Village Awards - MILFs In Their Thirties And Forties Only - 30 Mature Girls, 8 Hours, 2 Discs

  • censoredcreampiemarried womanABBAcenter villageABBA-498ABBA498h-086abba00498
    • 2020-12-07
    43 min

    [ore-730]ミチル

  • amateur censoredcreampieamateuroreore-730ore730ore-730
    • 2020-12-14
    86 min

    [SHH-011]These Big Tits Sisters Don't Like Me, But I Loosened Them Up With Aphrodisiacs And Now They're Obeying My Every Order In A Reverse Threesome Fuck Fest While My Wife Was Away, I Decided To Conduct A Fuck Comparison With My Stepdaughte

  • censoredbig titsSHHnatural highkansukeSHH-011SHH0111shh00011
    • 2021-01-03
    33 min

    FC2PPV 1630863 [Snow skin / Snow beautiful breasts] 20-year-old JD who both parents lost their jobs and had to expose their beautiful skin to earn school fees. A lascivious body that does not stop because love juice flows out to the extent that it ov

  • amateur uncensoredfc2
    • 2021-01-07
    479 min

    [CADV-797]Crystal Films 35th Anniversary - Super Sub Dirty Talk 10 Girls, 8-Hour Special

  • takei maki pretty censoredcreampieCADVcrystal picturecrystal exCADV-797CADV79749cadv00797
    • 2021-01-08
    53 min

    FC2PPV 1637111 [No] [Limited number of 1000pt OFF!] D-cup slender beautiful girl who is active as an idol and gonzo of dreams ♥ ️ Maskless raw blowjob ♥ ️ Raw insertion ♥ ️ Raw vaginal cum shot ♥ ️ * Review privilege ♥ ️ Complete appearance masturbat

  • amateur uncensoredfc2
    • 2021-01-16
    118 min

    [SSNI-968]I Always Hated My Girlfriend's Little Sister Because She Always Treated Me Without Any Respect, But We Were Stuck In The Same Room At A Hot Spring Resort Inn, So We Fucked Each Other So Hard I Thought I Was Going To Get Sick Mako Iga

  • iga mako censoredsingle workdramaSSNIs1 no 1 styletiger kosakaiSSNI-968SSNI968ssni00968
    • 2021-01-17
    105 min

    300MIUM-672 [I want to put raw chin in this ass! First place] Is it legally okay？ ？？ Rent a worried Lori beautiful girl as her! Completely REC the whole story that was spoiled up to the originally prohibited erotic acts by persuading! !! After enjoyi

  • amateur censoredcreampieamateurmiummium-672mium672300mium-672
    • 2021-01-27
    107 min

    [YAKO-022]This Miraculously Tiny Titty Lolita Babe Came And Answered Our Call, So We Gathered Everyone In The Office To Fuck Her Brains Out Shingo Mizawa # A Wannabe Idol # A Fake Interview # Yumeri

  • censoredcreampieamateurYAKOmercuryshinjuku undergroundYAKO-022YAKO022h-1133yako00022
    • 2021-02-13
    139 min

    [SQTE-358]Beautiful Girl With Black Hair Loves Having Sex And Receiving Creampies - Rei Kuruki

  • satoshi kuruki censoredcreampiesquirtingSQTEs cuteSQTE-358SQTE358sqte00358
    • 2021-02-22
    139 min

    [KATU-078]A Horny Snack Bar Mama With Erect Nipples This Horny Slut Was Super Beautiful With Glamorously Colossal Tits And A Huge Ass

  • censoredbig titsslutKATUkatsuo bussan mousouzokumaglowKATU-078KATU078katu00078
    • 2021-02-25
    117 min

    [SPRD-1379]A Surrogate Pregnancy Mom - Mirei Fujisaki

  • misaki fujisaki censoredmomsingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1379SPRD137918sprd01379
    • 2021-02-28
    61 min

    230OREX-236 Hinako-san

  • amateur censoredcreampieamateurorexorex-236orex236230orex-236
    • 2021-03-19
    243 min

    [KSBJ-125]Naked Wife Highlights vol. 6

  • ashamed anju minase censoredbig titsmarried womanKSBJksb planning emanuelKSBJ-125KSBJ125ksbj00125
    • 2021-03-19
    47 min

    FC2PPV 1671733 [Personal shooting] Appearance / Miya 20 years old / I’ve been doing all-you-can-eat, raw squirrel, and vaginal cum shot to a fair-skinned girl with big dicks! !!

  • amateur uncensoredfc2
    • 2021-03-27
    56 min

    230OREX-216 Ichika-chan

  • amateur censoredcreampieuniformorexorex-216orex216230orex-216
    • 2021-03-29
    47 min

    276KITAIKE-493 Yuka

  • amateur censoredbig titsamateurkitaikekitaike-493kitaike493276kitaike-493
    • 2021-04-10
    133 min

    [BADA-014]"This Is Revenge Against My Terrible Husband..." Sweet Beautiful Young Wife Asked To Be In A Porn So I Happily Fucked Her And Filled Her With Loads Of Cum

  • censoredbeautiful girlBADAbaltandaibutsu yoshidadiamondBADA-014BADA014bada00014
    • 2021-04-14
    154 min

    [SSIS-040]Body Fluid Play With A Middle Aged Man, Highly SK**led Sex With 11 Cum Shots Yura Kano

  • yura kanno censoredblowjobbeautiful girlSSISs1 no 1 stylemon cSSIS-040SSIS040ssis00040
    • 2021-04-17
    140 min

    [JUL-555]An Ultra Orgasmic And Horny G-Cup Titty Slut Has Cum Down To Bless Us All!! This Married Woman Receptionist Has Joined All Of The Men In The Office Together As Fellow Pussy Posse Members Tachibana-san (Not Her Real Name) 30 Years Old

  • censoredcreampiebig titsJULmadonnaJUL-555JUL555jul00555
    • 2021-04-21
    15 min

    10musume 042121_01 Please Watch Me Masturbating and Get Hard Mako Ashida

  • amateur uncensored10musume
    • 2021-04-22
    68 min

    435MFC-100 [Black Gal x Beautiful Legs Open Legs = Superb View] The Proportional Reiwa Gal and Raw Saddle 2nd Round! Contrary to her flashy appearance, the naughty things are surprisingly passive! ？？ I’m blaming and blaming in a position that ma

  • amateur censoredcreampiebig titsmfcmfc-100mfc100435mfc-100
    • 2021-05-14
    240 min

    [HUNTB-015]"Your Cum Gets Me So Horny!" None Of The Girls At School Like Me, But My Brand New Stepsister Turned Out To Be A Blowjob Junky？! She Seemed So Cute And Innocent...

  • censoredschoolgirlblowjobHUNTBhuntercognac kaminohhh groupHUNTB-015HUNTB015huntb00015
    • 2021-05-18
    135 min

    [STARS-374]Cum Dripping Infinite Ascension Costume Massage Parlor 4 COSPLAY 3 Sex Mei Miyajima

  • mei miyajima censoredcosplaybeautiful girlSTARSsod createzaku araisod starSTARS-374STARS3741stars00374
    • 2021-05-20
    180 min

    [KIR-035][Sensual Pleasure] Graphic Adulterous Sex Between Younger Brother And His Older Brother's Wife 180 Minutes

  • yuko gunji kohinata mai censoredcreampiemature womanKIRstar paradisekirei star paradiseKIR-035KIR035h-254kir00035
    • 2021-05-21
    119 min

    [JUL-578]Madonna "Dengeki Transfer" Part 2!! After My Husband Tries To Get Me Pregnant, My Father-in-law Always Follows Up By Filling My Pussy With His Own Cum... Kana Yume

  • kana yui censoredcreampiemature womanJULmadonnajotaro tomiJUL-578JUL578jul00578
    • 2021-06-02
    120 min

    [GVH-244]A Slutty Wife Who Seduces Men By Not Wearing Underwear Moved In Next Door! Hijiri Maihara

  • kiyoshi maihara censoredslutsingle workGVHglory questkabin kizakuraGVH-244GVH24413gvh00244
    • 2021-06-04
    119 min

    [SSIS-083]Even Though My Girlfriend Is Right Nearby Her Sexy Older Sister Seduced Me By Getting Up Close And Whispering Dirty Talk Into My Ear Riri Nanatsumori

  • nanatsumori riri censoredbig titssingle workSSISs1 no 1 stylekyoseiSSIS-083SSIS083ssis00083
    • 2021-06-04
    60 min

    480FRIN-035 《Personal shooting》 Married nursery teacher 26 years old Parents and cheating SEX Hidden shooting

  • amateur censoredcreampiebig titsfrinfrin-035frin035480frin-035
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-20
    120 min

    [MOKO-036]Capturing Working Older Women Masturbating On Film By Setting Up A Secret Camera And Planting Sexy Books and Videos

  • censoredamateurmature womanMOKOstar paradisebumpy roadMOKO-036MOKO036h-254moko00036
    • 2021-06-20
    120 min

    [BLB-009]Big Black Dicks A Japanese Mature Woman Gets Fucked As Her Marriage Dissolves... This Working Married Woman Endures A Failing Economy And A Shameful Four-Way G*******g (Her First Black Dick Fuck Video!!) Nao Yuki

  • naoki yuuki censoredmature womansingle workBLBglobal media entertainmentjiro sadogashimablack beastBLB-009BLB009blb00009
    • 2021-06-25
    102 min

    [YSN-551]My Father-In-Law's A Stud And I'm A Nympho: We Bang Around The Clock Yuri Honma

  • really censoredcreampiebig titsYSNnonYSN-551YSN551h-127ysn00551
    • 2021-06-29
    32 min

    248HDG-521 Please Take My Wife Kaori

  • amateur censoredmarried womanamateurhdghdg-521hdg521248hdg-521
    • 2021-07-14
    168 min

    [BLK-509]Her Hobby Is Hunting For Men! She'll Mount Them With A Cowgirl And Make Them Cum! This Active Slut Gal Loves Cocks And Outdoor Sports, And Here She Is, Making Her Adult Video Debut!! Emily Tojo

  • emiri tojo censoredsingle workBLKkira kiramametaro mamezawakira kira black galBLK-509BLK509blk00509
    • 2021-07-19
    44 min

    FC2PPV 1926346 [No] SSS-Class Super Beautiful Female College Student! Former Lounge Girl Cute Max Girl! F Cup Transcendence Style! 【Selfie】

  • amateur uncensoredfc2
    • 2021-07-20
    109 min

    [OFKU-185]My Bride's Mother, Who Came To Tokyo From Kochi...My Colossally Busty Mother-In-Law From Tosa: Natsuki Fujioka, 51 Years Old

  • natsuki fujioka censoredcreampiemature womanOFKUstar paradisemom railOFKU-185OFKU185h-254ofku00185
    • 2021-07-22
    191 min

    [FSDSS-262]Double Little Devil Teasing You'll Get Full-Body Lip Treatment, All Licking, All The Time A Harlem Reverse Threesome Fuck Fest Ena Satsuki Meisa Kawakita

  • ena satsuki kawakita meisa censoredbeautiful girlslutFSDSSfalenokicchomufaleno starFSDSS-262FSDSS2621fsdss00262
    • 2021-07-30
    120 min

    [RBK-022]After Confining 2 Beautiful Girls And Breaking Them In For Several Months, They Became My Devoted Sex Servants. Hana Shiromomo, Asuka Momose

  • white peach momose asuka censoredschoolgirlbeautiful girlRBKattackerskitorune kawaguchiryuu bakuRBK-022RBK022rbk00022
    • 2021-09-10
    122 min

    [UMD-793]I Lost My Virginity to My Aunt. Returns 12

  • shinoda yu suzuki mayu censoredsluthandjobUMDleodragon nishikawaUMD-793UMD793125umd00793
    • 2021-09-18
    61 min

    300NTK-635 [Echiechi Bomb Slender God Body Beauty Jd On The Verge Of Libido Explosion Echiechi Swimsuit Shooting! !! ] Kanekoma! ？？ Nonnon ♪ Yara Nakoma ♪ Swimsuit Shooting With A Horny Beautiful Girl Who Wants To Radiate Sexual Desire … There I

  • jdsex censoredcreampieamateurntkntk-635ntk635300ntk-635
    • 2021-10-14
    205 min

    [ABW-154]顔射の美学 17 美女の顔面に溜まりに溜まった白濁男汁をぶちまけろ！！ 時田萌々【MGSだけのおまけ映像付き 20分】

  • amateur censoredsquirtingamateurabwabw-154abw154abw-154
    • 2021-10-15
    112 min

    [KAM-092]An Amateur NTR Posting Peeping Videos Of Cuckold Fucking With A Son"s Wife I Filmed A POV Video Of It And Made A Posting Of It Her Father-In-Law Got Hot And Horny For Her Sexy Colossal Tits And Ass, And Massively Creampie Fucked Her

  • censoredcreampiebig titsKAMkarumagroupKAM-092KAM092kam00092
    • 2021-10-22
    146 min

    [DASD-931]She"ll Dribble And Drool All Over Your Rock Hard Nipples The Entire Time She"ll Warm You With Slick And Slippery Slobber And Suck Your Cock This Slut S********l Likes To Play By Licking And Getting You Nice And Slippery Meru Ito

  • ito meru censoreduniformschoolgirlDASDdassamoariDASD-931DASD931dasd00931
    • 2021-10-23
    121 min

    [JUE-002]Folk Tale From Countryside Village, Beautiful Widow"s Secret Reiko Kobayakawa

  • kobayakawa reiko censoredbig titsmature womanJUEglobal media entertainmentakabane kikujiroujukueiJUE-002JUE002jue00002
    • 2021-10-24
    106 min

    390JNT-032 [Do You Hate Girls Who Lick Her Toes？ ] Lee ● Posting Erotic Selfies On The Star, Picking Up G Cup Nurses On Sns! !! Devour The Best Body Of Bain Bain’s Huge Breasts And Perfect Proportions! !! Super Sensitive Ma ◯ Co Where The Bed Is

  • amateur censoredcreampiebig titsjntjnt-032jnt032390jnt-032
    • 2021-11-04
    106 min

    [AKDL-147]"Hey, Let"s Have Sex". Day I Was Beaten By Suddden Invitation From Daughter-in-law"s Friend. Ena With Innocent Smile Requests Forbidden Path. Satsuki Ena

  • ena satsuki censoredbeautiful girlslutAKDLaquinoriaquinoriaknrAKDL-147AKDL1471akdl00147
    • 2021-11-13
    127 min

    FC2PPV 2428227 Sakipo-Chan Last Leaked! Super Libido From Abstinence 3 Sex 3 Vaginal Cum Shot + 1 Facial Cumshot! [Saki Hatsumi, 20 Uncensored Final Outflows, 2 Hours Of High Image Quality] * With Luxurious Benefits

  • amateur uncensoredfc2



    • Jav Cherry, watch JAV streaming online japanese xxx